BLAST Search Results

BLASTP 2.2.11 [Jun-05-2005]


Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= GLEAN3_23584
         (2141 letters)

Database: NCBI Protein Reference Sequences 
           2,768,456 sequences; 999,999,922 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ref|XP_785809.2|  PREDICTED: similar to apolipoprotein B [St...  3286   0.0  
ref|XP_786858.2|  PREDICTED: similar to apolipoprotein B, pa...  3248   0.0  
ref|XP_800206.2|  PREDICTED: similar to apolipoprotein B [St...  3118   0.0  
ref|XP_001181437.1|  PREDICTED: hypothetical protein, partia...   621   e-176
ref|NP_001038098.1|  apolipoprotein B (including Ag(x) antig...   394   e-107
ref|NP_062160.1|  apolipoprotein B [Rattus norvegicus]            345   2e-092
ref|XP_532887.2|  PREDICTED: similar to Apolipoprotein B-100...   338   1e-090
ref|XP_001097404.1|  PREDICTED: apolipoprotein B isoform 1 [...   331   2e-088
ref|XP_001097500.1|  PREDICTED: apolipoprotein B isoform 2 [...   331   2e-088
ref|XP_001142038.1|  PREDICTED: apolipoprotein B isoform 2 [...   328   1e-087
ref|XP_515323.2|  PREDICTED: apolipoprotein B isoform 3 [Pan...   328   1e-087
ref|XP_001141877.1|  PREDICTED: apolipoprotein B isoform 1 [...   328   1e-087
ref|NP_000375.2|  apolipoprotein B precursor [Homo sapiens]       328   1e-087
ref|XP_001182866.1|  PREDICTED: hypothetical protein [Strong...   262   1e-067
ref|XP_001193875.1|  PREDICTED: hypothetical protein, partia...   260   4e-067
ref|XP_971721.1|  PREDICTED: similar to CG15828-PB, isoform ...   259   8e-067
ref|NP_001025233.1|  hypothetical protein LOC321166 [Danio r...   256   9e-066
ref|XP_583646.3|  PREDICTED: similar to apolipoprotein B, pa...   234   2e-059
ref|XP_001237622.1|  ENSANGP00000018828 [Anopheles gambiae s...   209   1e-051
ref|XP_394269.3|  PREDICTED: similar to CG15828-PB, isoform ...   194   3e-047
ref|XP_001356369.1|  GA13976-PA [Drosophila pseudoobscura]        188   2e-045
ref|NP_995670.1|  CG15828-PB, isoform B [Drosophila melanoga...   186   9e-045
ref|XP_606415.3|  PREDICTED: hypothetical protein [Bos taurus]    168   2e-039
ref|NP_609304.1|  CG15828-PA, isoform A [Drosophila melanoga...   168   2e-039
ref|XP_001178596.1|  PREDICTED: similar to apolipophorin pre...   151   2e-034
ref|XP_795269.2|  PREDICTED: similar to apolipophorin precur...   151   2e-034
ref|XP_392490.3|  PREDICTED: similar to Retinoid- and fatty-...   134   3e-029
ref|XP_321226.3|  ENSANGP00000018348 [Anopheles gambiae str....   111   3e-022
ref|XP_001352351.1|  GA10736-PA [Drosophila pseudoobscura]        107   4e-021
ref|NP_524634.2|  Retinoid- and fatty-acid binding protein C...    96   1e-017
ref|NP_001004408.1|  hypothetical protein LOC424547 [Gallus ...    90   1e-015
ref|NP_001026447.1|  hypothetical protein LOC424533 [Gallus ...    82   2e-013
ref|XP_001255069.1|  PREDICTED: similar to apo-B100 [Bos tau...    69   2e-009
ref|NP_001038378.1|  hypothetical protein LOC559931 [Danio r...    69   2e-009
>ref|XP_785809.2| PREDICTED: similar to apolipoprotein B [Strongylocentrotus
            purpuratus]
 ref|XP_001193188.1| PREDICTED: similar to apolipoprotein B [Strongylocentrotus
            purpuratus]
          Length = 5356

 Score = 3286 bits (8520), Expect = 0.0
 Identities = 1652/1687 (97%), Positives = 1663/1687 (98%), Gaps = 2/1687 (0%)

Query: 455  GTRFGQEV-VPEL-ECSELTRFKEGYSYTFKYEAETESGIKGAGPGSNMTMTCDIIIEAP 512
            G  FG +  V E+ ECSELTRFKEGYSYTFKYEAETESGIKGAGPGSNMTMTCDIIIEAP
Sbjct: 20   GPLFGSQASVDEVNECSELTRFKEGYSYTFKYEAETESGIKGAGPGSNMTMTCDIIIEAP 79

Query: 513  ERCRNVLKARRCLLENRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGILSM 572
            ERCRNVLKAR CLLENRDLDEEMSAHDLVFRT  GRI+EVLAHPDEPLHILNAKRGILSM
Sbjct: 80   ERCRNVLKARGCLLENRDLDEEMSAHDLVFRTDKGRIVEVLAHPDEPLHILNAKRGILSM 139

Query: 573  IQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENM 632
            IQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENM
Sbjct: 140  IQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENM 199

Query: 633  TRWQSFKDMVLNMTVMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSFWPMNFNSESGVR 692
            TRWQSFKDMVLNMTVMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSFWPMNFNSESGVR
Sbjct: 200  TRWQSFKDMVLNMTVMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSFWPMNFNSESGVR 259

Query: 693  TFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTADQAMDILKALVK 752
            TFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTADQAMDILKALVK
Sbjct: 260  TFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTADQAMDILKALVK 319

Query: 753  SSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIAREYL 812
            SSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIAREYL
Sbjct: 320  SSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIAREYL 379

Query: 813  LDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQYSPS 872
            LDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQY+PS
Sbjct: 380  LDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQYAPS 439

Query: 873  QITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSAENERLALVAL 932
            QITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSAENERLALVAL
Sbjct: 440  QITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSAENERLALVAL 499

Query: 933  KAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQLRS 992
            KAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQLRS
Sbjct: 500  KAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQLRS 559

Query: 993  QVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIKNV 1052
            QVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHI+NV
Sbjct: 560  QVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIQNV 619

Query: 1053 VESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFESD 1112
            VESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFESD
Sbjct: 620  VESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFESD 679

Query: 1113 IIFNPESYLPQEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQTM 1172
            IIFNPESYLPQEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQTM
Sbjct: 680  IIFNPESYLPQEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQTM 739

Query: 1173 FDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQSSFGEPQVVDVI 1232
            FDTIDEKILSKVREFAEAQLGNWVTP SEPDNEV+ K+ KYGKKMKRQSSFGEPQVVDVI
Sbjct: 740  FDTIDEKILSKVREFAEAQLGNWVTPRSEPDNEVYNKQGKYGKKMKRQSSFGEPQVVDVI 799

Query: 1233 HENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLALIPYTMGIYEELLNK 1292
            HENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLALIPYTMGIYEELLNK
Sbjct: 800  HENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLALIPYTMGIYEELLNK 859

Query: 1293 TKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLRMKSQFSFNLP 1352
            TKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLRMKSQFS NLP
Sbjct: 860  TKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLRMKSQFSINLP 919

Query: 1353 KIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLN 1412
            KIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLN
Sbjct: 920  KIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLN 979

Query: 1413 NTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNA 1472
            NTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNA
Sbjct: 980  NTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNA 1039

Query: 1473 SYVAEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQIREGGAPAPMPFKSIGKRSTQ 1532
            SYVAEAPRFPFSGPNSFN+TLVNTDQALKAYTIDAQYKQIREGGAPAPM FKSIGKR+ Q
Sbjct: 1040 SYVAEAPRFPFSGPNSFNLTLVNTDQALKAYTIDAQYKQIREGGAPAPMLFKSIGKRNKQ 1099

Query: 1533 NAPAFTKLIDTVRVSFYAPGEELTRNITSLVSVDRLRKTAKWTFTVPEVKNFIMFAGILN 1592
            NAPAFTKLIDTVRVSFYAPGEELTRNITSLVSVDRLRKTAKWTFTVPEVKNFIMFAGILN
Sbjct: 1100 NAPAFTKLIDTVRVSFYAPGEELTRNITSLVSVDRLRKTAKWTFTVPEVKNFIMFAGILN 1159

Query: 1593 ETTDXXXXXRAVFNVSAAENTASVDFLVRNETSLAQKNLTAVFNASVNSLYWAAVGQFVN 1652
            ETTD     RAVFNVSAAENTASVDFLVRNETSLAQKNLTAVFNAS+NSLYWAAVGQFVN
Sbjct: 1160 ETTDSSSSYRAVFNVSAAENTASVDFLVRNETSLAQKNLTAVFNASINSLYWAAVGQFVN 1219

Query: 1653 QSNNGDWNAHLTDTYYWDNETPLYKQLLFPWTGYQINHAKYQTSTITARRVTRGPMVKRD 1712
            QSNNGDWNAHLTDTYYWDNETPLYKQLLFPWTGYQINHAKYQTSTITARRVTRGPMVKRD
Sbjct: 1220 QSNNGDWNAHLTDTYYWDNETPLYKQLLFPWTGYQINHAKYQTSTITARRVTRGPMVKRD 1279

Query: 1713 LKMATLDWAFDFNTVETVTDELKELTVHTQISNATWEFPLLDVTLRKETTVNGYRDTVQV 1772
            LKMATLDWAFDFNTVETVTDELKELTVHTQISNATWEFPLLDVTLRKETTVNGYRDTVQV
Sbjct: 1280 LKMATLDWAFDFNTVETVTDELKELTVHTQISNATWEFPLLDVTLRKETTVNGYRDTVQV 1339

Query: 1773 ARNTHHIFAEYDVTKEPRETNRNFRMGLRTDVLVNNPDVSMFLNSPVLLKLFGETALIDE 1832
            ARNTHHIFAEYDVTKEPRETN NFRMGLRTDVLVNNPDVSMFLNSPVLLKLFGETALIDE
Sbjct: 1340 ARNTHHIFAEYDVTKEPRETNSNFRMGLRTDVLVNNPDVSMFLNSPVLLKLFGETALIDE 1399

Query: 1833 PVVIDGGVKYRVLDQSSLTEEHLIQTSIFVPNLRSPQTHLTYDFDLRLENATISNQMDYS 1892
            PVVIDGGV +R LDQSSLTEEHLIQTSIFVPNLRSPQTHLTYDFDLRLENATISNQMDYS
Sbjct: 1400 PVVIDGGVNFRFLDQSSLTEEHLIQTSIFVPNLRSPQTHLTYDFDLRLENATISNQMDYS 1459

Query: 1893 LELTTPIPLLKMNNVNFLHLMIDMESGTSALDHTYTLYDTRYSKPQVTVSNSIGAGWKKP 1952
            LELTTPIPLLKMNNVNFLHLMIDMESGTSALDHTYTLYDTRYSKPQVTVSNSIGAGWKKP
Sbjct: 1460 LELTTPIPLLKMNNVNFLHLMIDMESGTSALDHTYTLYDTRYSKPQVTVSNSIGAGWKKP 1519

Query: 1953 SANWVMDISTPTMVYFQNYTALYSCENGLQFFSENSQDSVSDLLDFTEISNLSVRPSAVS 2012
            SANWVMDISTPTMVYFQNYTALYSCENGLQFFSENSQDSVSDLLDFTEISNLSVRPSAVS
Sbjct: 1520 SANWVMDISTPTMVYFQNYTALYSCENGLQFFSENSQDSVSDLLDFTEISNLSVRPSAVS 1579

Query: 2013 MYWSYLHQLFSTNVSNSLVVDGPVTEMSPRLVPMIMRDMLNKTFSRDFSSVKDLVLNKFI 2072
            MYWSYLHQLFSTNVSNSLVVDGPVTEMSPRLVPMIMRDMLNKTFSRDFSSVKDLVLNKFI
Sbjct: 1580 MYWSYLHQLFSTNVSNSLVVDGPVTEMSPRLVPMIMRDMLNKTFSRDFSSVKDLVLNKFI 1639

Query: 2073 FNVTSSTLTLRQSANMSSPVIANISASHYIFLSQSLFDQKLSFAAEQKRLNISAGLNHSL 2132
            FNVTSSTLTLRQSANMSSPVIANISASHYIFLSQSLFDQKLSFAAEQKRLNISAGLNHSL
Sbjct: 1640 FNVTSSTLTLRQSANMSSPVIANISASHYIFLSQSLFDQKLSFAAEQKRLNISAGLNHSL 1699

Query: 2133 LIEDREI 2139
            LIEDREI
Sbjct: 1700 LIEDREI 1706

 Score =  652 bits (1681), Expect = 0.0
 Identities = 324/361 (89%), Positives = 334/361 (92%), Gaps = 3/361 (0%)

Query: 127  QNETSLAQKNLTAVFNASVNSLYWAAVGQFVNQSNNGDWNAHLTDTYYWDNETPLYKQLL 186
            +NETSLAQKNLTAVFNAS+NSLYWAAVGQFVNQSNNGDWNAHLTDTYYWDNETPLYKQLL
Sbjct: 1188 RNETSLAQKNLTAVFNASINSLYWAAVGQFVNQSNNGDWNAHLTDTYYWDNETPLYKQLL 1247

Query: 187  FPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAFDFNTVETVTDELKELTVH 246
            FPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAFDFNTVETVTDELKELTVH
Sbjct: 1248 FPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAFDFNTVETVTDELKELTVH 1307

Query: 247  TQISNATWEFPLLDVTLRKETTVNGYRDTVQVARNTHHIFAEYDVTKEPRETNRNFRMGL 306
            TQISNATWEFPLLDVTLRKETTVNGYRDTVQVARNTHHIFAEYDVTKEPRETN NFRMGL
Sbjct: 1308 TQISNATWEFPLLDVTLRKETTVNGYRDTVQVARNTHHIFAEYDVTKEPRETNSNFRMGL 1367

Query: 307  RTDVLVNNPDVSMFLNSPVLLKLFGETALIDEPVVIDGGVNFRFLDQSSLTEEHLIQTSI 366
            RTDVLVNNPDVSMFLNSPVLLKLFGETALIDEPVVIDGGVNFRFLDQSSLTEEHLIQTSI
Sbjct: 1368 RTDVLVNNPDVSMFLNSPVLLKLFGETALIDEPVVIDGGVNFRFLDQSSLTEEHLIQTSI 1427

Query: 367  FVPNLRSPQTHLTYDFDLRLENAAIRNETDYSLELTTPIPLLKMNNVNFLHLMIDMESGT 426
            FVPNLRSPQTHLTYDFDLRLENA I N+ DYSLELTTPIPLLKMNNVNFLHLMIDMESGT
Sbjct: 1428 FVPNLRSPQTHLTYDFDLRLENATISNQMDYSLELTTPIPLLKMNNVNFLHLMIDMESGT 1487

Query: 427  SALEHTYTLYDTRYSKPQVTVSNSIGPFGTRFGQEVVPELECSELTRFKEGYSYTFKYEA 486
            SAL+HTYTLYDTRYSKPQVTVSNSIG    +     V ++    +  F+   +YT  Y  
Sbjct: 1488 SALDHTYTLYDTRYSKPQVTVSNSIGAGWKKPSANWVMDISTPTMVYFQ---NYTALYSC 1544

Query: 487  E 487
            E
Sbjct: 1545 E 1545

 Score =  261 bits (667), Expect = 2e-067
 Identities = 126/127 (99%), Positives = 127/127 (100%)

Query: 1    MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 60
            MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK
Sbjct: 939  MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 998

Query: 61   ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV 120
            ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFN+
Sbjct: 999  ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNL 1058

Query: 121  TLVNTDQ 127
            TLVNTDQ
Sbjct: 1059 TLVNTDQ 1065
>ref|XP_786858.2| PREDICTED: similar to apolipoprotein B, partial [Strongylocentrotus
            purpuratus]
 ref|XP_001182559.1| PREDICTED: similar to apolipoprotein B, partial [Strongylocentrotus
            purpuratus]
          Length = 1636

 Score = 3248 bits (8421), Expect = 0.0
 Identities = 1625/1631 (99%), Positives = 1626/1631 (99%)

Query: 453  PFGTRFGQEVVPELECSELTRFKEGYSYTFKYEAETESGIKGAGPGSNMTMTCDIIIEAP 512
            PFGTRFGQEVVPELECSELTRFKEGYSYTFKYEAETESGIKGAGPGSNMTMTCDIIIEAP
Sbjct: 1    PFGTRFGQEVVPELECSELTRFKEGYSYTFKYEAETESGIKGAGPGSNMTMTCDIIIEAP 60

Query: 513  ERCRNVLKARRCLLENRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGILSM 572
            ERCRNVLKARRCLLENRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGILSM
Sbjct: 61   ERCRNVLKARRCLLENRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGILSM 120

Query: 573  IQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENM 632
            IQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENM
Sbjct: 121  IQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENM 180

Query: 633  TRWQSFKDMVLNMTVMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSFWPMNFNSESGVR 692
            TRWQSFKDMVLNMTVMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSFWPMNFNSESGVR
Sbjct: 181  TRWQSFKDMVLNMTVMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSFWPMNFNSESGVR 240

Query: 693  TFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTADQAMDILKALVK 752
            TFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTADQAMDILKALVK
Sbjct: 241  TFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTADQAMDILKALVK 300

Query: 753  SSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIAREYL 812
            SSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIAREYL
Sbjct: 301  SSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIAREYL 360

Query: 813  LDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQYSPS 872
            LDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQYSPS
Sbjct: 361  LDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQYSPS 420

Query: 873  QITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSAENERLALVAL 932
            QITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSAENERLALVAL
Sbjct: 421  QITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSAENERLALVAL 480

Query: 933  KAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQLRS 992
            KAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQLRS
Sbjct: 481  KAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQLRS 540

Query: 993  QVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIKNV 1052
            QVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIKNV
Sbjct: 541  QVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIKNV 600

Query: 1053 VESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFESD 1112
            VESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFESD
Sbjct: 601  VESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFESD 660

Query: 1113 IIFNPESYLPQEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQTM 1172
            IIFNPESYLPQEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQTM
Sbjct: 661  IIFNPESYLPQEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQTM 720

Query: 1173 FDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQSSFGEPQVVDVI 1232
            FDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQSSFGEPQVVDVI
Sbjct: 721  FDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQSSFGEPQVVDVI 780

Query: 1233 HENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLALIPYTMGIYEELLNK 1292
            HENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLALIPYTMGIYEELLNK
Sbjct: 781  HENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLALIPYTMGIYEELLNK 840

Query: 1293 TKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLRMKSQFSFNLP 1352
            TKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLRMKSQFSFNLP
Sbjct: 841  TKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLRMKSQFSFNLP 900

Query: 1353 KIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLN 1412
            KIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLN
Sbjct: 901  KIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLN 960

Query: 1413 NTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNA 1472
            NTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNA
Sbjct: 961  NTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNA 1020

Query: 1473 SYVAEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQIREGGAPAPMPFKSIGKRSTQ 1532
            SYVAEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQIREGGAPAPMPFKSIGKRSTQ
Sbjct: 1021 SYVAEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQIREGGAPAPMPFKSIGKRSTQ 1080

Query: 1533 NAPAFTKLIDTVRVSFYAPGEELTRNITSLVSVDRLRKTAKWTFTVPEVKNFIMFAGILN 1592
            NAPAFTKLIDTVRVSFYAPGEELTRNITSLVSVDRLRKTAKWTFTVPEVKNFIMFAGILN
Sbjct: 1081 NAPAFTKLIDTVRVSFYAPGEELTRNITSLVSVDRLRKTAKWTFTVPEVKNFIMFAGILN 1140

Query: 1593 ETTDXXXXXRAVFNVSAAENTASVDFLVRNETSLAQKNLTAVFNASVNSLYWAAVGQFVN 1652
            ETTD     RAVFNVSAAENTASVDFLVRNETSLAQKNLTAVFNASVNSLYWAAVGQFVN
Sbjct: 1141 ETTDSSSSSRAVFNVSAAENTASVDFLVRNETSLAQKNLTAVFNASVNSLYWAAVGQFVN 1200

Query: 1653 QSNNGDWNAHLTDTYYWDNETPLYKQLLFPWTGYQINHAKYQTSTITARRVTRGPMVKRD 1712
            QSNNGDWNAHLTDTYYWDNETPLYKQLLFPWTGYQINHAKYQTSTITARRVTRGPMVKRD
Sbjct: 1201 QSNNGDWNAHLTDTYYWDNETPLYKQLLFPWTGYQINHAKYQTSTITARRVTRGPMVKRD 1260

Query: 1713 LKMATLDWAFDFNTVETVTDELKELTVHTQISNATWEFPLLDVTLRKETTVNGYRDTVQV 1772
            LKMATLDWAFDFNTVETVTDELKELTVHTQISNATWEFPLLDVTLRKETTVNGYRDTVQV
Sbjct: 1261 LKMATLDWAFDFNTVETVTDELKELTVHTQISNATWEFPLLDVTLRKETTVNGYRDTVQV 1320

Query: 1773 ARNTHHIFAEYDVTKEPRETNRNFRMGLRTDVLVNNPDVSMFLNSPVLLKLFGETALIDE 1832
            ARNTHHIFAEYDVTKEPRETNRNFRMGLRTDVLVNNPDVSMFLNSPVLLKLFGETALIDE
Sbjct: 1321 ARNTHHIFAEYDVTKEPRETNRNFRMGLRTDVLVNNPDVSMFLNSPVLLKLFGETALIDE 1380

Query: 1833 PVVIDGGVKYRVLDQSSLTEEHLIQTSIFVPNLRSPQTHLTYDFDLRLENATISNQMDYS 1892
            PVVIDGGVKYRVLDQSSLTEEHLIQTSIFVPNLRSPQTHLTYDFDLRLENATISNQMDYS
Sbjct: 1381 PVVIDGGVKYRVLDQSSLTEEHLIQTSIFVPNLRSPQTHLTYDFDLRLENATISNQMDYS 1440

Query: 1893 LELTTPIPLLKMNNVNFLHLMIDMESGTSALDHTYTLYDTRYSKPQVTVSNSIGAGWKKP 1952
            LELTTPIPLLKMNNVNFLHLMIDMESGTSALDHTYTLYDTRYSKPQVTVSNSIGAGWKKP
Sbjct: 1441 LELTTPIPLLKMNNVNFLHLMIDMESGTSALDHTYTLYDTRYSKPQVTVSNSIGAGWKKP 1500

Query: 1953 SANWVMDISTPTMVYFQNYTALYSCENGLQFFSENSQDSVSDLLDFTEISNLSVRPSAVS 2012
            SANWVMDISTPTMVYFQNYTALYSCENGLQFFSENSQDSVSDLLDFTEISNLSVRPSAVS
Sbjct: 1501 SANWVMDISTPTMVYFQNYTALYSCENGLQFFSENSQDSVSDLLDFTEISNLSVRPSAVS 1560

Query: 2013 MYWSYLHQLFSTNVSNSLVVDGPVTEMSPRLVPMIMRDMLNKTFSRDFSSVKDLVLNKFI 2072
            MYWSYLHQLFSTNVSNSLVVDGPVTEMSPRLVPMIMRDMLNKTFSRDFSSVKDLVLNKFI
Sbjct: 1561 MYWSYLHQLFSTNVSNSLVVDGPVTEMSPRLVPMIMRDMLNKTFSRDFSSVKDLVLNKFI 1620

Query: 2073 FNVTSSTLTLR 2083
            FNVTSSTLTL+
Sbjct: 1621 FNVTSSTLTLQ 1631

 Score =  648 bits (1672), Expect = 0.0
 Identities = 323/361 (89%), Positives = 333/361 (92%), Gaps = 3/361 (0%)

Query: 127  QNETSLAQKNLTAVFNASVNSLYWAAVGQFVNQSNNGDWNAHLTDTYYWDNETPLYKQLL 186
            +NETSLAQKNLTAVFNASVNSLYWAAVGQFVNQSNNGDWNAHLTDTYYWDNETPLYKQLL
Sbjct: 1169 RNETSLAQKNLTAVFNASVNSLYWAAVGQFVNQSNNGDWNAHLTDTYYWDNETPLYKQLL 1228

Query: 187  FPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAFDFNTVETVTDELKELTVH 246
            FPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAFDFNTVETVTDELKELTVH
Sbjct: 1229 FPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAFDFNTVETVTDELKELTVH 1288

Query: 247  TQISNATWEFPLLDVTLRKETTVNGYRDTVQVARNTHHIFAEYDVTKEPRETNRNFRMGL 306
            TQISNATWEFPLLDVTLRKETTVNGYRDTVQVARNTHHIFAEYDVTKEPRETNRNFRMGL
Sbjct: 1289 TQISNATWEFPLLDVTLRKETTVNGYRDTVQVARNTHHIFAEYDVTKEPRETNRNFRMGL 1348

Query: 307  RTDVLVNNPDVSMFLNSPVLLKLFGETALIDEPVVIDGGVNFRFLDQSSLTEEHLIQTSI 366
            RTDVLVNNPDVSMFLNSPVLLKLFGETALIDEPVVIDGGV +R LDQSSLTEEHLIQTSI
Sbjct: 1349 RTDVLVNNPDVSMFLNSPVLLKLFGETALIDEPVVIDGGVKYRVLDQSSLTEEHLIQTSI 1408

Query: 367  FVPNLRSPQTHLTYDFDLRLENAAIRNETDYSLELTTPIPLLKMNNVNFLHLMIDMESGT 426
            FVPNLRSPQTHLTYDFDLRLENA I N+ DYSLELTTPIPLLKMNNVNFLHLMIDMESGT
Sbjct: 1409 FVPNLRSPQTHLTYDFDLRLENATISNQMDYSLELTTPIPLLKMNNVNFLHLMIDMESGT 1468

Query: 427  SALEHTYTLYDTRYSKPQVTVSNSIGPFGTRFGQEVVPELECSELTRFKEGYSYTFKYEA 486
            SAL+HTYTLYDTRYSKPQVTVSNSIG    +     V ++    +  F+   +YT  Y  
Sbjct: 1469 SALDHTYTLYDTRYSKPQVTVSNSIGAGWKKPSANWVMDISTPTMVYFQ---NYTALYSC 1525

Query: 487  E 487
            E
Sbjct: 1526 E 1526

 Score =  262 bits (670), Expect = 1e-067
 Identities = 127/127 (100%), Positives = 127/127 (100%)

Query: 1    MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 60
            MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK
Sbjct: 920  MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 979

Query: 61   ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV 120
            ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV
Sbjct: 980  ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV 1039

Query: 121  TLVNTDQ 127
            TLVNTDQ
Sbjct: 1040 TLVNTDQ 1046
>ref|XP_800206.2| PREDICTED: similar to apolipoprotein B [Strongylocentrotus
            purpuratus]
 ref|XP_001182635.1| PREDICTED: similar to apolipoprotein B [Strongylocentrotus
            purpuratus]
          Length = 1794

 Score = 3118 bits (8084), Expect = 0.0
 Identities = 1559/1690 (92%), Positives = 1617/1690 (95%), Gaps = 2/1690 (0%)

Query: 452  GPFGTRFGQEVVPELECSELTRFKEGYSYTFKYEAETESGIKGAGPGSNMTMTCDIIIEA 511
            GPFGTRFGQEV PELECSELTRFKEGYSYTF YEAETESGIKGAGPGS  TMTC+I IEA
Sbjct: 20   GPFGTRFGQEVEPELECSELTRFKEGYSYTFNYEAETESGIKGAGPGSTSTMTCNIAIEA 79

Query: 512  PERCRNVLKARRCLLE-NRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGIL 570
            PERCRNVLK   C L+ N  L +EMSAHD+V+RT  GRIIEV+AHPDEP+HILNAKRGIL
Sbjct: 80   PERCRNVLKVTSCSLDGNPQLGDEMSAHDVVYRTDKGRIIEVVAHPDEPIHILNAKRGIL 139

Query: 571  SMIQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEE 630
            SMIQLDLEADDVDQITLNEVSVHGNCSSEMTVT+RDD+QRPRKLQVVT+LNNCMLRK+ E
Sbjct: 140  SMIQLDLEADDVDQITLNEVSVHGNCSSEMTVTKRDDRQRPRKLQVVTDLNNCMLRKRAE 199

Query: 631  NMTRWQSFKDMVLNMTVMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSFWPMNFNSESG 690
            NMTRWQSFKD+VLNMTVMDKFINSSKTCSYDLKGTTGEFRGI+CEEVHSFWPMNFNS+SG
Sbjct: 200  NMTRWQSFKDIVLNMTVMDKFINSSKTCSYDLKGTTGEFRGIECEEVHSFWPMNFNSDSG 259

Query: 691  VRTFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTADQAMDILKAL 750
            VRT+IQQRLIS  I+ LNS+KVDPA SRSTCL YE DPK++GKK DDVTADQAMDILKAL
Sbjct: 260  VRTYIQQRLISNTIENLNSFKVDPAISRSTCLSYELDPKDVGKKPDDVTADQAMDILKAL 319

Query: 751  VKSSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIARE 810
            VKSSREEV+MESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIARE
Sbjct: 320  VKSSREEVRMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIARE 379

Query: 811  YLLDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQYS 870
            YLLDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQYS
Sbjct: 380  YLLDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQYS 439

Query: 871  PSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSAENERLALV 930
            PSQITIFPLSIMVHNYWMNNEEIHTAATLPEPI+KTIRYLKSL+GNDCTVSAENERLALV
Sbjct: 440  PSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIIKTIRYLKSLVGNDCTVSAENERLALV 499

Query: 931  ALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQL 990
            ALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQL
Sbjct: 500  ALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQL 559

Query: 991  RSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIK 1050
            RSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELT +W+FLKTEPVNQMKAFCYSHI+
Sbjct: 560  RSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTGLWSFLKTEPVNQMKAFCYSHIQ 619

Query: 1051 NVVESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFE 1110
            NVVESSEPTLQE K NLKIAM GEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQ E
Sbjct: 620  NVVESSEPTLQELKKNLKIAMIGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQLE 679

Query: 1111 SDIIFNPESYLPQEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQ 1170
            SD+IF+PESYLPQE+MFHYVLNALGKS DIFETGIEMKGFEPIIESVFGPEGFFPEVKLQ
Sbjct: 680  SDVIFSPESYLPQEIMFHYVLNALGKSWDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQ 739

Query: 1171 TMFDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQSSFGEPQVVD 1230
            TMF+TIDEKILSKVREFAEAQLGNWVTPTSEPDNEV+ K+ KYGKKMKRQSSFGEPQVVD
Sbjct: 740  TMFETIDEKILSKVREFAEAQLGNWVTPTSEPDNEVYNKQGKYGKKMKRQSSFGEPQVVD 799

Query: 1231 VIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLALIPYTMGIYEELL 1290
            +IHENTMNKLNQLHYLVGMEPSATDATVFLRL GNEFGFVSASDVLALIPYTMGIYEELL
Sbjct: 800  MIHENTMNKLNQLHYLVGMEPSATDATVFLRLLGNEFGFVSASDVLALIPYTMGIYEELL 859

Query: 1291 NKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLRMKSQFSFN 1350
            NKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLRMKSQFS N
Sbjct: 860  NKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLRMKSQFSIN 919

Query: 1351 LPKIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKIN 1410
            LPKIIAAGHVAPSGAVEVLATMGIG+PTKVFTGVMANATVYHSSMLAGNITIDGTHLKIN
Sbjct: 920  LPKIIAAGHVAPSGAVEVLATMGIGLPTKVFTGVMANATVYHSSMLAGNITIDGTHLKIN 979

Query: 1411 LNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYP 1470
            LNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAV+SQRCTNVSKVFGVDLCVSWAYP
Sbjct: 980  LNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVRSQRCTNVSKVFGVDLCVSWAYP 1039

Query: 1471 NASYVAEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQIREGGAPAPMPFKSIGKRS 1530
            NASYVA+APRFPFSGPNSFNVTL+NTDQALKAYTIDAQYKQIREGGAPAPM FKSIGKRS
Sbjct: 1040 NASYVAKAPRFPFSGPNSFNVTLINTDQALKAYTIDAQYKQIREGGAPAPMSFKSIGKRS 1099

Query: 1531 TQNAPAFTKLIDTVRVSFYAPGEELTRNITSLVSVDRLRKTAKWTFTVPEVKNFIMFAGI 1590
             QNAPAFTKLIDTVRVSFYAPGEELTRNITSLVSVDRLRKTAKWTFTVPEVKNFIMFAGI
Sbjct: 1100 KQNAPAFTKLIDTVRVSFYAPGEELTRNITSLVSVDRLRKTAKWTFTVPEVKNFIMFAGI 1159

Query: 1591 LNETTDXXXXXRAVFNVSAAENTASVDFLVRNETSLAQKNLTAVFNASVNSLYWAAVGQF 1650
            LNETTD     RAVFNVSAAENTASVDFLVRNETSLAQKNLTAVFNAS+NSLYWAAVGQF
Sbjct: 1160 LNETTDSSSSYRAVFNVSAAENTASVDFLVRNETSLAQKNLTAVFNASINSLYWAAVGQF 1219

Query: 1651 VNQSNNGDWNAHLTDTYYWDNETPLYKQLLFPWTGYQINHAKYQTSTITARRVTRGPMVK 1710
               SNNGDWNAHLTDTYYWDNETPLYKQLLFPWTGYQINHAKYQTSTITARRVTRGPMVK
Sbjct: 1220 FKPSNNGDWNAHLTDTYYWDNETPLYKQLLFPWTGYQINHAKYQTSTITARRVTRGPMVK 1279

Query: 1711 RDLKMATLDWAFDFNTVETVTDELKELTVHTQISNATWEFPLLDVTLRKETTVNGYRDTV 1770
            RDLKMATLDWAFDFNTV+TVTDELKELTVHTQISNATWEFPLLDVTLR  T VNGYR   
Sbjct: 1280 RDLKMATLDWAFDFNTVQTVTDELKELTVHTQISNATWEFPLLDVTLRNVTNVNGYRLEG 1339

Query: 1771 QVARNTHHIFAEYDVTKEPRETNRNFRMGLRTDVLVNNPDVSMFLNSPVLLKLFGETALI 1830
            QVAR+THHIFAEYDVTKEPRETN+NFRMGLRTDVLVNNPDVSMFLNSPVLLKLFGETALI
Sbjct: 1340 QVARSTHHIFAEYDVTKEPRETNKNFRMGLRTDVLVNNPDVSMFLNSPVLLKLFGETALI 1399

Query: 1831 DEPVVIDGGVKYRVLDQSSLTEEHLIQTSIFVPNLRSPQTHLTYDFDLRLENATISNQMD 1890
            DEPVVIDGGV +R+LDQSSLTEE LIQTSIFVPN RSPQTHLTYDFDLRLENATIS++ D
Sbjct: 1400 DEPVVIDGGVNFRILDQSSLTEERLIQTSIFVPNPRSPQTHLTYDFDLRLENATISDRKD 1459

Query: 1891 YSLELTTPIPLLKMNNVNFLHLMIDMESGTSALDHTYTLYDTRYSKPQVTVSNSIGAGWK 1950
            YSLELTTPI LLK+NN+N LHLMIDMESGTS LDHTYTLYDTRYSKPQVTVSNSIGAGWK
Sbjct: 1460 YSLELTTPITLLKINNINLLHLMIDMESGTSTLDHTYTLYDTRYSKPQVTVSNSIGAGWK 1519

Query: 1951 KPSANWVMDISTPTMVYFQNYTALYSCENGLQFFSENSQD-SVSDLLDFTEISNLSVRPS 2009
            KP ANW + I TP+ VY QNYTALY+ +NGLQFF ENSQD S+SDLL+F EISN SVRPS
Sbjct: 1520 KPLANWALTIETPSSVYLQNYTALYTSDNGLQFFYENSQDSSLSDLLNFIEISNWSVRPS 1579

Query: 2010 AVSMYWSYLHQLFSTNVSNSLVVDGPVTEMSPRLVPMIMRDMLNKTFSRDFSSVKDLVLN 2069
            A+SMY SY+HQL STNVSNSLV+ GPVTEM PRLVPMIMRDMLNK+FSRDFSSVKDLVLN
Sbjct: 1580 AISMYTSYIHQLISTNVSNSLVLGGPVTEMRPRLVPMIMRDMLNKSFSRDFSSVKDLVLN 1639

Query: 2070 KFIFNVTSSTLTLRQSANMSSPVIANISASHYIFLSQSLFDQKLSFAAEQKRLNISAGLN 2129
            KFIFNVTSSTLTLRQSANMSSP IAN+SASHYIFLSQSLF+QKLSFAAEQKRLNISA LN
Sbjct: 1640 KFIFNVTSSTLTLRQSANMSSPAIANLSASHYIFLSQSLFEQKLSFAAEQKRLNISAALN 1699

Query: 2130 HSLLIEDREI 2139
            HSLLIEDREI
Sbjct: 1700 HSLLIEDREI 1709

 Score =  607 bits (1564), Expect = e-171
 Identities = 298/326 (91%), Positives = 307/326 (94%)

Query: 127  QNETSLAQKNLTAVFNASVNSLYWAAVGQFVNQSNNGDWNAHLTDTYYWDNETPLYKQLL 186
            +NETSLAQKNLTAVFNAS+NSLYWAAVGQF   SNNGDWNAHLTDTYYWDNETPLYKQLL
Sbjct: 1190 RNETSLAQKNLTAVFNASINSLYWAAVGQFFKPSNNGDWNAHLTDTYYWDNETPLYKQLL 1249

Query: 187  FPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAFDFNTVETVTDELKELTVH 246
            FPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAFDFNTV+TVTDELKELTVH
Sbjct: 1250 FPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAFDFNTVQTVTDELKELTVH 1309

Query: 247  TQISNATWEFPLLDVTLRKETTVNGYRDTVQVARNTHHIFAEYDVTKEPRETNRNFRMGL 306
            TQISNATWEFPLLDVTLR  T VNGYR   QVAR+THHIFAEYDVTKEPRETN+NFRMGL
Sbjct: 1310 TQISNATWEFPLLDVTLRNVTNVNGYRLEGQVARSTHHIFAEYDVTKEPRETNKNFRMGL 1369

Query: 307  RTDVLVNNPDVSMFLNSPVLLKLFGETALIDEPVVIDGGVNFRFLDQSSLTEEHLIQTSI 366
            RTDVLVNNPDVSMFLNSPVLLKLFGETALIDEPVVIDGGVNFR LDQSSLTEE LIQTSI
Sbjct: 1370 RTDVLVNNPDVSMFLNSPVLLKLFGETALIDEPVVIDGGVNFRILDQSSLTEERLIQTSI 1429

Query: 367  FVPNLRSPQTHLTYDFDLRLENAAIRNETDYSLELTTPIPLLKMNNVNFLHLMIDMESGT 426
            FVPN RSPQTHLTYDFDLRLENA I +  DYSLELTTPI LLK+NN+N LHLMIDMESGT
Sbjct: 1430 FVPNPRSPQTHLTYDFDLRLENATISDRKDYSLELTTPITLLKINNINLLHLMIDMESGT 1489

Query: 427  SALEHTYTLYDTRYSKPQVTVSNSIG 452
            S L+HTYTLYDTRYSKPQVTVSNSIG
Sbjct: 1490 STLDHTYTLYDTRYSKPQVTVSNSIG 1515

 Score =  258 bits (658), Expect = 2e-066
 Identities = 123/127 (96%), Positives = 127/127 (100%)

Query: 1    MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 60
            MGIG+PTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK
Sbjct: 941  MGIGLPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 1000

Query: 61   ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV 120
            ANGDIEFIPGVLQDAV+SQRCTNVSKVFGVDLCVSWAYPNASYVA+APRFPFSGPNSFNV
Sbjct: 1001 ANGDIEFIPGVLQDAVRSQRCTNVSKVFGVDLCVSWAYPNASYVAKAPRFPFSGPNSFNV 1060

Query: 121  TLVNTDQ 127
            TL+NTDQ
Sbjct: 1061 TLINTDQ 1067
>ref|XP_001181437.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus
            purpuratus]
          Length = 1283

 Score =  621 bits (1602), Expect = e-176
 Identities = 311/339 (91%), Positives = 318/339 (93%)

Query: 1483 FSGPNSFNVTLVNTDQALKAYTIDAQYKQIREGGAPAPMPFKSIGKRSTQNAPAFTKLID 1542
            F+  + F++      +ALKAYTIDAQYKQIREGGAPAPM FKSIGKR+ QNAPAFTKLID
Sbjct: 945  FAAKDEFSLINELPMRALKAYTIDAQYKQIREGGAPAPMLFKSIGKRNKQNAPAFTKLID 1004

Query: 1543 TVRVSFYAPGEELTRNITSLVSVDRLRKTAKWTFTVPEVKNFIMFAGILNETTDXXXXXR 1602
            TVRVSFYAPGEELTRNITSLVSVDRLRKTAKWTFTVPEVKNFIMFAGILNETTD     R
Sbjct: 1005 TVRVSFYAPGEELTRNITSLVSVDRLRKTAKWTFTVPEVKNFIMFAGILNETTDSSSSYR 1064

Query: 1603 AVFNVSAAENTASVDFLVRNETSLAQKNLTAVFNASVNSLYWAAVGQFVNQSNNGDWNAH 1662
            AVFNVSAAENTASVDFLVRNETSLAQKNLTAVFNAS+NSLYWAAVGQFVNQSNNGDWNAH
Sbjct: 1065 AVFNVSAAENTASVDFLVRNETSLAQKNLTAVFNASINSLYWAAVGQFVNQSNNGDWNAH 1124

Query: 1663 LTDTYYWDNETPLYKQLLFPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAF 1722
            LTDTYYWDNETPLYKQLLFPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAF
Sbjct: 1125 LTDTYYWDNETPLYKQLLFPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAF 1184

Query: 1723 DFNTVETVTDELKELTVHTQISNATWEFPLLDVTLRKETTVNGYRDTVQVARNTHHIFAE 1782
            DFNTVETVTDELKELTVHTQISNATWEFPLLDVTLR ETTVNGYR   QVARNTHHIFAE
Sbjct: 1185 DFNTVETVTDELKELTVHTQISNATWEFPLLDVTLRNETTVNGYRLEGQVARNTHHIFAE 1244

Query: 1783 YDVTKEPRETNRNFRMGLRTDVLVNNPDVSMFLNSPVLL 1821
            YDVTKEPRETN NFRMGLRTDVLVNNPDVSMFLNSPVLL
Sbjct: 1245 YDVTKEPRETNSNFRMGLRTDVLVNNPDVSMFLNSPVLL 1283

 Score =  401 bits (1031), Expect = e-109
 Identities = 194/201 (96%), Positives = 196/201 (97%)

Query: 127  QNETSLAQKNLTAVFNASVNSLYWAAVGQFVNQSNNGDWNAHLTDTYYWDNETPLYKQLL 186
            +NETSLAQKNLTAVFNAS+NSLYWAAVGQFVNQSNNGDWNAHLTDTYYWDNETPLYKQLL
Sbjct: 1083 RNETSLAQKNLTAVFNASINSLYWAAVGQFVNQSNNGDWNAHLTDTYYWDNETPLYKQLL 1142

Query: 187  FPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAFDFNTVETVTDELKELTVH 246
            FPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAFDFNTVETVTDELKELTVH
Sbjct: 1143 FPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAFDFNTVETVTDELKELTVH 1202

Query: 247  TQISNATWEFPLLDVTLRKETTVNGYRDTVQVARNTHHIFAEYDVTKEPRETNRNFRMGL 306
            TQISNATWEFPLLDVTLR ETTVNGYR   QVARNTHHIFAEYDVTKEPRETN NFRMGL
Sbjct: 1203 TQISNATWEFPLLDVTLRNETTVNGYRLEGQVARNTHHIFAEYDVTKEPRETNSNFRMGL 1262

Query: 307  RTDVLVNNPDVSMFLNSPVLL 327
            RTDVLVNNPDVSMFLNSPVLL
Sbjct: 1263 RTDVLVNNPDVSMFLNSPVLL 1283
>ref|NP_001038098.1| apolipoprotein B (including Ag(x) antigen) [Gallus gallus]
          Length = 4631

 Score =  394 bits (1013), Expect = e-107
 Identities = 305/1140 (26%), Positives = 536/1140 (47%), Gaps = 135/1140 (11%)

Query: 468  CS-ELTRFKEGYSYTFKYEAETESGIKG-AGPGSNMTMTCDIIIEAPERCRNVLKARRCL 525
            CS +  RFK    Y + YEAET SGI G A   S   +TC + +E P+ C+ +L+   C 
Sbjct: 31   CSKDAARFKSLRKYVYLYEAETSSGITGTADSRSGSKITCKVELEVPQLCQFILRTMHCS 90

Query: 526  LENR------------------DLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKR 567
            L                     D    MS H+L F TQ+G  +++    DEPL++LN KR
Sbjct: 91   LRETFGVDSERRAMLRKSKNSDDFANAMSKHELRFSTQDGTKVKLYPEKDEPLNVLNLKR 150

Query: 568  GILSMIQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRK 627
            GI+S +    E ++  + T++  +V+G C SE+         + R+  V  +++     K
Sbjct: 151  GIISALLAPTETEENIK-TISMDTVYGKCDSEVEF-------KSRRGSVAEDISINRNLK 202

Query: 628  QEENMTRWQSFKDMV-----LNMTVMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSFWP 682
              +N +  + +   V     LN+  +   ++S+++C Y +       R + C E H F P
Sbjct: 203  ACDNFSPIRDYVSPVAIVKGLNIP-LSTLLSSTQSCHYSIDAKKKHIRDVVCSEKHLFLP 261

Query: 683  MNFNSESGVRTFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTADQ 742
             ++ ++ G+ T + Q L      R+N+   D        L  E    +  ++ D V    
Sbjct: 262  SSYKNQYGMMTEVNQTLKLEDNQRMNNRNPDGDELEEKGLALESTDAKFSRQGDAV---- 317

Query: 743  AMDILKALVKSSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNP 802
             + IL+ L K +  +   +  +LF ++ + L  ++N T+  +  +    S+         
Sbjct: 318  -LKILQELQKLTASQQNQQRAKLFYKFVSGLRSLHNSTLGSLVPKMMETSS--------- 367

Query: 803  DKEKIAREYLLDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSE 862
                      +  L+ C T  C+S     +  G V   +      T+ L   PT + + E
Sbjct: 368  -------SITIQALIQCGTPECYSAVLQILRTGNVNPLVVDLVTYTLGLLPSPTPKRIRE 420

Query: 863  MLRMAQYSPSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSA 922
            +L MAQY PS+ + + LS  V  ++  NE++     + E I     ++ SL+G DC+  A
Sbjct: 421  ILNMAQYQPSRASFYGLSHAVTKFY--NEKM----IVTEEITDVADFMVSLLGTDCSGDA 474

Query: 923  ENERLALVALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMR 982
            E   L  + L+AIGN+G  +E+           +   L +C +N+     + KAAIQ+ R
Sbjct: 475  E---LTYLTLRAIGNMGAVMEKA-------KPSLKASLKTCIRNQAASLSVQKAAIQAFR 524

Query: 983  RFVMSDQLRSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMK 1042
            +  ++++ RS ++ E F++      +R+A YLI MK NPS ++L  I   L  E   Q+K
Sbjct: 525  KMTITEEDRSALLKE-FQEGDAPTDKRLATYLILMK-NPSPADLAKIMRILTREKNEQVK 582

Query: 1043 AFCYSHIKNVVESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRN 1102
            +F  SHI N+++S E  +++ K +++ A+ G E+P   KD RK+S+ +++SK ++ P   
Sbjct: 583  SFVASHIANILDSDEVGIEDLKSHVEEALKGNEVPT-AKDFRKFSQNYQVSKRVSVPGL- 640

Query: 1103 NTVAAQFESDIIFNPESYLPQEVMFHYVLNALG-KSMDIFETGIEMKGFEPIIESVFGPE 1161
            N ++A+ E ++IF+P SY+P+E M    LN  G    DIFE G++ KGFEP +E++FG +
Sbjct: 641  NPISAKVEGNVIFDPSSYVPKETMLKTTLNLYGFGPSDIFELGLDGKGFEPTLEALFGEK 700

Query: 1162 GFFPEVKLQTMFDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQS 1221
            GFFP+   + ++  +D K+  +V +      G                   Y    K+  
Sbjct: 701  GFFPDTASKALY-WVDGKVPEQVSKALFDYFG-------------------YSHDGKQDQ 740

Query: 1222 SFGEPQVVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLALIPY 1281
               +  ++++  E  + +L+        +  A +   FLR+ G E G++  SD   L   
Sbjct: 741  EITKAVILNL--EKLIKELS--------KKEAPEGRAFLRILGEELGYMKLSDFKLLGSV 790

Query: 1282 TMGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSL 1341
             +   + L    + I Q +S+G++ +    ++FMD  F +PTG G+ L  +++G  +V+ 
Sbjct: 791  ALECIKTLQRIPEIIAQAISKGVDKDLFVHYMFMDNEFELPTGAGLQLKFALSG--IVTP 848

Query: 1342 RMKSQFSFNLPKIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGNIT 1401
              K     +   + A     PS AVE +  +GI MP    +GV  N+ ++H S +  +++
Sbjct: 849  GAKVAVKLHQKSMQAELIAKPSVAVEFVTHLGINMPEFARSGVEMNSNIFHESGIEAHVS 908

Query: 1402 IDGTHLKINLNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTNVSKVFGV 1461
            +    LK ++     P  L + S T +L+ +    E IP ++++   S  C     + G+
Sbjct: 909  VKAGQLKFSIPAPKTPTKLLSISNTLHLV-SPAKTEEIPPLIENREFSTSCKPF--ISGL 965

Query: 1462 DLCVSWAYPNASYVAEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQIREGGAPAPM 1521
            + C    Y NAS +  AP +P +G   F V +V+T + +K Y+  A Y   REG      
Sbjct: 966  NFCTKLLYSNASSMEAAPYYPLTGETRFEVEIVSTGE-VKEYSASANYDLQREG------ 1018

Query: 1522 PFKSIGKRSTQNAPAFTKLIDTVRVSFYAPGEELTRNITSLVSVDRLRKTAKWTFTVPEV 1581
                            T L+DT++ +  A G +     T     +R RK      ++P+V
Sbjct: 1019 ----------------TDLVDTLKFAVQAEGVK-QHEATLTFKYNRDRKILTSDVSIPDV 1061

 Score = 64.3 bits (155), Expect = 5e-008
 Identities = 63/272 (23%), Positives = 113/272 (41%), Gaps = 20/272 (7%)

Query: 1    MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 60
            +GI MP    +GV  N+ ++H S +  ++++    LK ++     P  L + S T +L+ 
Sbjct: 879  LGINMPEFARSGVEMNSNIFHESGIEAHVSVKAGQLKFSIPAPKTPTKLLSISNTLHLV- 937

Query: 61   ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV 120
            +    E IP ++++   S  C     + G++ C    Y NAS +  AP +P +G   F V
Sbjct: 938  SPAKTEEIPPLIENREFSTSCKPF--ISGLNFCTKLLYSNASSMEAAPYYPLTGETRFEV 995

Query: 121  TLVNTDQNETSLAQKN--LTAVFNASVNSLYWAAVGQFVNQSNNGDWNAHLTDTYYWDNE 178
             +V+T + +   A  N  L       V++L +A   + V Q       A LT  Y  D +
Sbjct: 996  EIVSTGEVKEYSASANYDLQREGTDLVDTLKFAVQAEGVKQH-----EATLTFKYNRDRK 1050

Query: 179  TPLYKQLLFPWTGYQINHAKYQTSTITARRVTRGPMVKRDLKMATLDWAFDFNTVETVTD 238
              L   +  P                T  R+T   +  +   +  +D+     +  T+T 
Sbjct: 1051 I-LTSDVSIPDVDVDFG---------TNFRITDESVSGKKAYIFVIDFNNKKISEVTLTG 1100

Query: 239  ELKELTVHTQISNATWEFPLLDVTLRKETTVN 270
            +++   +   +   T   P L   L+ E  VN
Sbjct: 1101 QIRYAGIEEAMLRGTVSIPRLQTELKTEALVN 1132
>ref|NP_062160.1| apolipoprotein B [Rattus norvegicus]
          Length = 4743

 Score =  345 bits (884), Expect = 2e-092
 Identities = 278/1077 (25%), Positives = 500/1077 (46%), Gaps = 124/1077 (11%)

Query: 470  ELTRFKEGYSYTFKYEAETESGIKGAGPGSNMT-MTCDIIIEAPERCRNVLKARRCLLE- 527
            + TRFK    Y + YEAE+ SG++G     + T + C + +E P+ C  +++  +C L+ 
Sbjct: 29   DATRFKHLRKYVYSYEAESSSGVRGTADSRSATKINCKVELEVPQVCTLIMRTSQCTLKE 88

Query: 528  -----------------NRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGIL 570
                             + +    MS ++L      G+ + +     EP +ILN KRGI+
Sbjct: 89   VYGFNPEGKALMKKTKNSEEFASAMSRYELKLAFPEGKRVALYPDLGEPNYILNIKRGII 148

Query: 571  SMIQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEE 630
            S + +  E ++  Q+   + +V+GNCS+++TV  R       K  V TE++       E 
Sbjct: 149  SALLVPPETEEDKQVLFQD-TVYGNCSTQVTVNSR-------KGTVATEMST------ER 194

Query: 631  NMTRWQSFKDMVLNMTVM----------DKFINSSKTCSYDLKGTTGEFRGIQCEEVHSF 680
            N+     F+ +  +++ +             I+SS++C Y L+          C E H F
Sbjct: 195  NLQHCDGFQPISTSVSPLALIKGLVRPLSTLISSSQSCQYTLEPKRKHVSEAICNEQHLF 254

Query: 681  WPMNFNSESGVRTFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTA 740
             P ++ ++ G+ T + Q+L      ++NS +          L +E        K     A
Sbjct: 255  LPFSYKNKYGIMTHVTQKLSLEDTPKINS-RFFRGGINQVGLAFESTKSTSPPKQ----A 309

Query: 741  DQAMDILKALVKSSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRD 800
            D  +  L+ L K S  E   +   LF +    L G++ E I  +                
Sbjct: 310  DAVLKTLQELKKLSISEQNAQRANLFHKLVTELRGLSGEAITSLL--------------- 354

Query: 801  NPDKEKIAREYLLDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELM 860
             P   +++    L  L+ C    C++     +        L       MAL   P+++ +
Sbjct: 355  -PQLIEVSSPITLQALIQCGQPECYTHILQWLKTEKAHPLLIDIVTYLMALIPNPSVQRL 413

Query: 861  SEMLRMAQYSPSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTV 920
             E+   A+   S+ T++ LS  V++Y+   +  H+ + + E I     YL   I N+C  
Sbjct: 414  QEIFNTAKELQSRATLYALSHAVNSYYAIMD--HSRSPVLEDIAG---YLMKQIDNECM- 467

Query: 921  SAENERLALVALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQS 980
              + +R  L+ L+ IGN+G  +ER           +   +++C ++ +    I KAA+Q+
Sbjct: 468  -GDEDRTFLI-LRVIGNMGRTMERV-------MPALKSSVLNCVRSTKPSLQIQKAALQA 518

Query: 981  MRRFVMSDQLRSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQ 1040
            +R+  M D++R+ ++ + F +    V +R+AAYL+ M++ PS S++  I   L+ E   Q
Sbjct: 519  LRKMEMGDEVRT-ILFDTFVNDVAPVEKRLAAYLLLMRS-PSSSDINKIAKLLQWEQSEQ 576

Query: 1041 MKAFCYSHIKNVVESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPW 1100
            +K F  SHI N++ S E  +Q+ K  +K A+    LP    D RK+SR +++SK+++ P 
Sbjct: 577  VKNFVASHIANILNSEELYVQDLKNLIKNALVNSRLPTI-MDFRKFSRNYQISKSVSIPL 635

Query: 1101 RNNTVAAQFESDIIFNPESYLPQEVMFHYVLNALG-KSMDIFETGIEMKGFEPIIESVFG 1159
             +  V+A+ E +++F+P SYLP+E M    L   G  S+D+FE G+E KGFEP +E++FG
Sbjct: 636  FD-PVSAKIEGNLVFDPSSYLPKESMLKTTLTVFGIASLDLFEIGLEGKGFEPTLEALFG 694

Query: 1160 PEGFFPEVKLQTMFDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKR 1219
             +GFFP+   + ++  ++ ++  +V +      G             + K DK+ + M  
Sbjct: 695  KQGFFPDSVNKALY-WVNGQVPDRVSKVLVDHFG-------------YTKDDKHEQDMVN 740

Query: 1220 QSSFGEPQVVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLALI 1279
                G   +VD + +   +K               +A  +LR+ G E GFV   D+  L 
Sbjct: 741  ----GIMPIVDKLIKELKSK------------EIPEARAYLRILGKELGFVRLQDLQVLG 784

Query: 1280 PYTMGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVV 1339
               +   +      + I Q + +G   +    ++FM+ +F +PTG+G+ L  S +G  V 
Sbjct: 785  KLLLNGAQTFRGVPQMIVQAIREGSKDDLFLHYIFMENAFELPTGVGLQLQVSSSG--VF 842

Query: 1340 SLRMKSQFSFNLPKIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGN 1399
            +  +K+     L  I A     PS ++E +  MGI +P    +GV  N   +H S L   
Sbjct: 843  TPGIKAGVRLELANIQAELVAKPSVSLEFVTNMGIIIPDFAKSGVQMNTNFFHESGLEAR 902

Query: 1400 ITIDGTHLKINLNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTNVSKVF 1459
            + +    LK+ + +  RP+ LF+ S T +L+      E IP ++++      C    K F
Sbjct: 903  VALKAGQLKVIIPSPKRPVKLFSGSNTLHLVSTT-KTEVIPPLIENRKSWSTC----KPF 957

Query: 1460 --GVDLCVSWAYPNASYVAEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQIRE 1514
              G++ C + AY NAS    A  +P +G   + + L  T + ++ Y+  A Y+ ++E
Sbjct: 958  FTGMNYCTTGAYSNASSTESASYYPLTGDTRYELELKPTGE-VEQYSASATYELLKE 1013

 Score = 58.5 bits (140), Expect = 3e-006
 Identities = 45/164 (27%), Positives = 76/164 (46%), Gaps = 9/164 (5%)

Query: 1    MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 60
            MGI +P    +GV  N   +H S L   + +    LK+ + +  RP+ LF+ S T +L+ 
Sbjct: 875  MGIIIPDFAKSGVQMNTNFFHESGLEARVALKAGQLKVIIPSPKRPVKLFSGSNTLHLVS 934

Query: 61   ANGDIEFIPGVLQDAVQSQRCTNVSKVF--GVDLCVSWAYPNASYVAEAPRFPFSGPNSF 118
                 E IP ++++      C    K F  G++ C + AY NAS    A  +P +G   +
Sbjct: 935  TT-KTEVIPPLIENRKSWSTC----KPFFTGMNYCTTGAYSNASSTESASYYPLTGDTRY 989

Query: 119  NVTLVNTDQNE--TSLAQKNLTAVFNASVNSLYWAAVGQFVNQS 160
             + L  T + E  ++ A   L     + V++L +    + V QS
Sbjct: 990  ELELKPTGEVEQYSASATYELLKEDKSLVDTLKFLVQAEGVQQS 1033
>ref|XP_532887.2| PREDICTED: similar to Apolipoprotein B-100 precursor (Apo B-100)
            [Canis familiaris]
          Length = 4500

 Score =  338 bits (868), Expect = 1e-090
 Identities = 276/1085 (25%), Positives = 488/1085 (44%), Gaps = 139/1085 (12%)

Query: 472  TRFKEGYSYTFKYEAETESGIKGAGPGSNMT-MTCDIIIEAPERCRNVLKARRCLLE--- 527
            TRFK    Y + YEAE+ S I G     + T + C + +E P+ C  +++  +C L+   
Sbjct: 113  TRFKHLRKYVYNYEAESSSSIPGTTDSRSATRINCKVELEVPQLCNFIVRTSQCTLKEGN 172

Query: 528  ---------------NRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGILSM 572
                           + +    MS ++L      G+ + +    +EP HILN KRG++S 
Sbjct: 173  GFNPKGRPSLHKTKNSEEFAAAMSKYELRLAIPEGKQVLLYPEKEEPTHILNIKRGLISA 232

Query: 573  IQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENM 632
            + +  E +   Q+   + +V+GNCSS++TV  R       K  V TE++       E N+
Sbjct: 233  LLVPPETEADKQVLFLD-TVYGNCSSDLTVNAR-------KANVATEISI------ERNL 278

Query: 633  TRWQSFKDMVLNMTVM----------DKFINSSKTCSYDLKGTTGEFRGIQCEEVHSFWP 682
             +   FK +   ++ +             I+S+++C Y L           C+E H F P
Sbjct: 279  EKCDHFKPISTGVSPLALIKGMVRPLSTLISSNQSCQYTLDPKKKHVSEAICKEQHLFLP 338

Query: 683  MNFNSESGVRTFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTADQ 742
             ++ ++ G+ T + Q L      ++NS   D               KE+G   +   +  
Sbjct: 339  FSYENKYGIMTQVTQTLKLEDTPKINSRFFDEG------------AKEVGLAFESTKSTS 386

Query: 743  AMDILKALVKSSRE-------EVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYS 795
                 +A+VK+ +E       E   +   LF +    L G+NNE +  +           
Sbjct: 387  PPKQAEAIVKTIQELQTLHVSEQNAQRANLFNKLVTELRGLNNEALTTLL---------- 436

Query: 796  QTCRDNPDKEKIAREYLLDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYP 855
                  P   +++    L  L+ C    C++     +        L       +AL   P
Sbjct: 437  ------PKLMEVSSPITLQALIQCGQSQCYTHILQWLRSEKANPLLIDVVTYLVALTPEP 490

Query: 856  TLELMSEMLRMAQYSPSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIG 915
            + E + E+   AQ   S+ T++ LS +V+NY   N  +       + ++    YL   + 
Sbjct: 491  SAERLQEIFSTAQEQQSRATLYALSHVVNNYHKANPVV------TQDLLNIADYLLEQLQ 544

Query: 916  NDCTVSAENERLALVALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISK 975
            + CT    NE    + L+ IGN+G  +E         + R++  ++ C ++ +    I K
Sbjct: 545  DSCT---GNEDHTYLILRVIGNMGRTMETV-------APRLTSSILKCIQSTEPSLLIQK 594

Query: 976  AAIQSMRRFVMSDQLRSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKT 1035
            AAIQ++R+  + D++R +V+ ++F D      +R+AAYL+ M++ PS S++  I   L  
Sbjct: 595  AAIQALRKMELKDEVR-EVLLQVFLDDASPGEKRLAAYLMLMRS-PSQSDINQITQLLPR 652

Query: 1036 EPVNQMKAFCYSHIKNVVESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKN 1095
            E   Q+K F  SHI N++ S E  +++ K  ++ A+ G +LP    D  K+SR + LSK+
Sbjct: 653  EQNEQVKNFVASHIANILNSEELYIKDLKKLVEGALKGSQLPTI-MDFSKFSRNYHLSKS 711

Query: 1096 LTEPWRNNTVAAQFESDIIFNPESYLPQEVMFHYVLNALGKS-MDIFETGIEMKGFEPII 1154
            ++ P   + ++ + E ++IF+P +YLP+E M    L   G +  D+FE G+E KGFEP +
Sbjct: 712  VSLP-SLDPISGKIEGNLIFDPNNYLPKESMLKTTLTVFGLAPADLFEIGLEGKGFEPTL 770

Query: 1155 ESVFGPEGFFPEVKLQTMFDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYG 1214
            E++FG +GFFP+   + ++  +D+++   V                   ++V +    Y 
Sbjct: 771  EALFGKQGFFPDSVNKALY-WVDDQVPDHV-------------------SKVLVDHFGYT 810

Query: 1215 KKMKRQSSFGEPQVVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASD 1274
            K  KR+       +++V  E  +  L    +         +A  +L + G E GFV   D
Sbjct: 811  KDGKREQDMVNGIMLNV--ERLIKDLKSKEF--------PEARAYLHILGEELGFVRLHD 860

Query: 1275 VLALIPYTMGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSIN 1334
            +  L    +     L    + I + + +GL  +    ++FMD +F +PTG+G+ L  S +
Sbjct: 861  LQLLGKMLLNGVHTLAGIPQMIGEAIRKGLKNDLFLHYIFMDNAFELPTGLGLQLQVSSS 920

Query: 1335 GTAVVSLRMKSQFSFNLPKIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSS 1394
            G  V++  MK+     +  ++      PS ++E +  MGI +P    TG+  N   +H +
Sbjct: 921  G--VITPGMKAGMKVEMANLLTELVAKPSVSMEFVTNMGIIIPDFSKTGIQMNTNFFHET 978

Query: 1395 MLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTN 1454
             L   I      LK  + +  RP+ LF+ S T +L+      E  P       +S++  +
Sbjct: 979  GLEMQIAFKAGRLKFVIPSPTRPVKLFSGSNTLHLVSTTKTEEVAP-----LNESRKSWS 1033

Query: 1455 VSKVF--GVDLCVSWAYPNASYVAEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQI 1512
              K    G+D C S AY  A+    A  +P S    F + L  T + ++ Y+    Y+  
Sbjct: 1034 TCKPLFTGLDYCSSGAYSTANSPESASYYPLSRDTRFELELKPTGE-VEQYSASVSYELQ 1092

Query: 1513 REGGA 1517
            REGGA
Sbjct: 1093 REGGA 1097
>ref|XP_001097404.1| PREDICTED: apolipoprotein B isoform 1 [Macaca mulatta]
          Length = 4535

 Score =  331 bits (848), Expect = 2e-088
 Identities = 279/1079 (25%), Positives = 488/1079 (45%), Gaps = 123/1079 (11%)

Query: 470  ELTRFKEGYSYTFKYEAETESGIKGAGPGSNMT-MTCDIIIEAPERCRNVLKARRCLLE- 527
            + TRFK    YT+ YEAE+ SG+ G     + T + C + +E P+ C  +LK  +C L+ 
Sbjct: 38   DTTRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKE 97

Query: 528  -----------------NRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGIL 570
                             + +    MS ++L      G+ + +    DEP HILN KRGI+
Sbjct: 98   VYGFNPEGRALLKKTKNSEEFAAAMSRYELKLVIPEGKQVFLYPEKDEPTHILNIKRGII 157

Query: 571  SMIQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEE 630
            S + +  E ++  Q+   + +V+GNCS+  TV       + RK  V TE++       E 
Sbjct: 158  SALLVPPETEETKQVLFLD-TVYGNCSTHFTV-------KTRKGNVATEIST------ER 203

Query: 631  NMTRWQSFKD---------MVLNMT-VMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSF 680
            ++ +   FK          ++  MT  +   I+SS++C Y L           C+E H F
Sbjct: 204  DLGQCDRFKPIRTGVSPLALIKGMTHPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLF 263

Query: 681  WPMNFNSESGVRTFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTA 740
             P ++ +  G+   + Q L      ++NS +     ++   L +E        K     A
Sbjct: 264  LPFSYKNMYGMGVQVTQTLKLEDTPKINS-RFFGEGTKKVGLAFESTKSTSPPKQ----A 318

Query: 741  DQAMDILKALVKSSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRD 800
            +  +  L+ L K +  E  ++   LF +    L G++ E +  +                
Sbjct: 319  EAVLKTLQELKKLTISEQNIQRANLFHKLVTELRGLSEEAVTSLL--------------- 363

Query: 801  NPDKEKIAREYLLDGLLPCTTMACFSVKNYAIAKGVVPKPLA-SAWMVTMALQNYPTLEL 859
             P   +++    L  L+ C    C S       K V   PL        +AL   P+ + 
Sbjct: 364  -PQLIEVSSPITLQALVQCGQPQC-STHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQ 421

Query: 860  MSEMLRMAQYSPSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCT 919
            + E+  MA+   S+ T++ LS  V+NY   N       T  + ++    YL   I +DCT
Sbjct: 422  LREIFNMAREQRSRATLYALSHAVNNYHETNP------TGTQELLDIANYLMEQIQDDCT 475

Query: 920  VSAENERLALVALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQ 979
                +E    + L+ IGN+G+ +E+        +  +   ++ C ++ +    I KAAIQ
Sbjct: 476  ---GDEDYTYLILRVIGNMGQTMEQV-------TPELKSSILKCVQSTKPSLMIQKAAIQ 525

Query: 980  SMRRFVMSDQLRSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVN 1039
            ++R+    D+   +V+ + F D      +R+AAYL+ M++ PS +++  I   L  E   
Sbjct: 526  ALRKMEPKDE-DQEVLLQTFLDDASPGDKRLAAYLMLMRS-PSQADINKIVQLLPREQNE 583

Query: 1040 QMKAFCYSHIKNVVESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEP 1099
            Q+K F  SHI N++ S E  +Q+ K  +K A+   +LP    D RK+SR + L K+++ P
Sbjct: 584  QVKNFVASHIANILNSEELDIQDLKKLVKEALKESQLPTV-MDFRKFSRNYRLYKSVSLP 642

Query: 1100 WRNNTVAAQFESDIIFNPESYLPQEVMFHYVLNALG-KSMDIFETGIEMKGFEPIIESVF 1158
               +  +A+ E ++IF+P +YLP+E M    L A G  S D+FE G+E KGFEP +E++F
Sbjct: 643  -SLDPASAKIEGNLIFDPNNYLPKETMLKTTLTAFGFASADLFEIGLEGKGFEPTLEALF 701

Query: 1159 GPEGFFPEVKLQTMFDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMK 1218
            G +GFFP+              ++K   +   Q+ + V+     D+  + K+DK  + M 
Sbjct: 702  GKQGFFPD-------------SVNKALYWVNGQVPDGVSKVL-VDHFGYTKEDKREQDMV 747

Query: 1219 RQSSFGEPQVVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLAL 1278
                F   ++++ +                      +A  +LR+ G E GF    D+  L
Sbjct: 748  NGMMFTVQKLIEDLKSK----------------EVPEARAYLRILGEELGFARLHDLQLL 791

Query: 1279 IPYTMGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAV 1338
                +     L    + I +++ +G   +    ++F++ +F +PTG G+ L  S +G  V
Sbjct: 792  GKLLLTGARTLQGIPQMIGEVIRKGSKNDFFLHYIFIENAFELPTGAGLQLQISSSG--V 849

Query: 1339 VSLRMKSQFSFNLPKIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAG 1398
             +  +K+     +  + A     PS +VE +  MGI +P    +GV  N   +H S L  
Sbjct: 850  TAPGIKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQMNTNFFHESGLEA 909

Query: 1399 NITIDGTHLKINLNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTNVSKV 1458
            ++ +    LK  + +  +P+ L + S T +L+      E IP ++++      C  +   
Sbjct: 910  HVALKAGQLKFIIPSPKKPVKLLSGSNTLHLVSTT-KTEVIPPLIENRQSLSVCKQL--F 966

Query: 1459 FGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQIREGGA 1517
             G++ C S AY NAS    AP +P +G     + L  T + ++ Y++ A Y+  RE  A
Sbjct: 967  TGLNYCTSSAYSNASSTDSAPYYPLTGDTRLELELRPTGE-VEQYSVSATYELQREDRA 1024
>ref|XP_001097500.1| PREDICTED: apolipoprotein B isoform 2 [Macaca mulatta]
          Length = 4555

 Score =  331 bits (848), Expect = 2e-088
 Identities = 279/1079 (25%), Positives = 488/1079 (45%), Gaps = 123/1079 (11%)

Query: 470  ELTRFKEGYSYTFKYEAETESGIKGAGPGSNMT-MTCDIIIEAPERCRNVLKARRCLLE- 527
            + TRFK    YT+ YEAE+ SG+ G     + T + C + +E P+ C  +LK  +C L+ 
Sbjct: 38   DTTRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKE 97

Query: 528  -----------------NRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGIL 570
                             + +    MS ++L      G+ + +    DEP HILN KRGI+
Sbjct: 98   VYGFNPEGRALLKKTKNSEEFAAAMSRYELKLVIPEGKQVFLYPEKDEPTHILNIKRGII 157

Query: 571  SMIQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEE 630
            S + +  E ++  Q+   + +V+GNCS+  TV       + RK  V TE++       E 
Sbjct: 158  SALLVPPETEETKQVLFLD-TVYGNCSTHFTV-------KTRKGNVATEIST------ER 203

Query: 631  NMTRWQSFKD---------MVLNMT-VMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSF 680
            ++ +   FK          ++  MT  +   I+SS++C Y L           C+E H F
Sbjct: 204  DLGQCDRFKPIRTGVSPLALIKGMTHPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLF 263

Query: 681  WPMNFNSESGVRTFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTA 740
             P ++ +  G+   + Q L      ++NS +     ++   L +E        K     A
Sbjct: 264  LPFSYKNMYGMGVQVTQTLKLEDTPKINS-RFFGEGTKKVGLAFESTKSTSPPKQ----A 318

Query: 741  DQAMDILKALVKSSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRD 800
            +  +  L+ L K +  E  ++   LF +    L G++ E +  +                
Sbjct: 319  EAVLKTLQELKKLTISEQNIQRANLFHKLVTELRGLSEEAVTSLL--------------- 363

Query: 801  NPDKEKIAREYLLDGLLPCTTMACFSVKNYAIAKGVVPKPLA-SAWMVTMALQNYPTLEL 859
             P   +++    L  L+ C    C S       K V   PL        +AL   P+ + 
Sbjct: 364  -PQLIEVSSPITLQALVQCGQPQC-STHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQ 421

Query: 860  MSEMLRMAQYSPSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCT 919
            + E+  MA+   S+ T++ LS  V+NY   N       T  + ++    YL   I +DCT
Sbjct: 422  LREIFNMAREQRSRATLYALSHAVNNYHETNP------TGTQELLDIANYLMEQIQDDCT 475

Query: 920  VSAENERLALVALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQ 979
                +E    + L+ IGN+G+ +E+        +  +   ++ C ++ +    I KAAIQ
Sbjct: 476  ---GDEDYTYLILRVIGNMGQTMEQV-------TPELKSSILKCVQSTKPSLMIQKAAIQ 525

Query: 980  SMRRFVMSDQLRSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVN 1039
            ++R+    D+   +V+ + F D      +R+AAYL+ M++ PS +++  I   L  E   
Sbjct: 526  ALRKMEPKDE-DQEVLLQTFLDDASPGDKRLAAYLMLMRS-PSQADINKIVQLLPREQNE 583

Query: 1040 QMKAFCYSHIKNVVESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEP 1099
            Q+K F  SHI N++ S E  +Q+ K  +K A+   +LP    D RK+SR + L K+++ P
Sbjct: 584  QVKNFVASHIANILNSEELDIQDLKKLVKEALKESQLPTV-MDFRKFSRNYRLYKSVSLP 642

Query: 1100 WRNNTVAAQFESDIIFNPESYLPQEVMFHYVLNALG-KSMDIFETGIEMKGFEPIIESVF 1158
               +  +A+ E ++IF+P +YLP+E M    L A G  S D+FE G+E KGFEP +E++F
Sbjct: 643  -SLDPASAKIEGNLIFDPNNYLPKETMLKTTLTAFGFASADLFEIGLEGKGFEPTLEALF 701

Query: 1159 GPEGFFPEVKLQTMFDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMK 1218
            G +GFFP+              ++K   +   Q+ + V+     D+  + K+DK  + M 
Sbjct: 702  GKQGFFPD-------------SVNKALYWVNGQVPDGVSKVL-VDHFGYTKEDKREQDMV 747

Query: 1219 RQSSFGEPQVVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLAL 1278
                F   ++++ +                      +A  +LR+ G E GF    D+  L
Sbjct: 748  NGMMFTVQKLIEDLKSK----------------EVPEARAYLRILGEELGFARLHDLQLL 791

Query: 1279 IPYTMGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAV 1338
                +     L    + I +++ +G   +    ++F++ +F +PTG G+ L  S +G  V
Sbjct: 792  GKLLLTGARTLQGIPQMIGEVIRKGSKNDFFLHYIFIENAFELPTGAGLQLQISSSG--V 849

Query: 1339 VSLRMKSQFSFNLPKIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAG 1398
             +  +K+     +  + A     PS +VE +  MGI +P    +GV  N   +H S L  
Sbjct: 850  TAPGIKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQMNTNFFHESGLEA 909

Query: 1399 NITIDGTHLKINLNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTNVSKV 1458
            ++ +    LK  + +  +P+ L + S T +L+      E IP ++++      C  +   
Sbjct: 910  HVALKAGQLKFIIPSPKKPVKLLSGSNTLHLVSTT-KTEVIPPLIENRQSLSVCKQL--F 966

Query: 1459 FGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQIREGGA 1517
             G++ C S AY NAS    AP +P +G     + L  T + ++ Y++ A Y+  RE  A
Sbjct: 967  TGLNYCTSSAYSNASSTDSAPYYPLTGDTRLELELRPTGE-VEQYSVSATYELQREDRA 1024
>ref|XP_001142038.1| PREDICTED: apolipoprotein B isoform 2 [Pan troglodytes]
          Length = 4542

 Score =  328 bits (842), Expect = 1e-087
 Identities = 282/1079 (26%), Positives = 488/1079 (45%), Gaps = 123/1079 (11%)

Query: 470  ELTRFKEGYSYTFKYEAETESGIKGAGPGSNMT-MTCDIIIEAPERCRNVLKARRCLLE- 527
            + TRFK    YT+ YEAE+ SG+ G     + T + C + +E P+ C  +LK  +C L+ 
Sbjct: 41   DATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKE 100

Query: 528  -----------------NRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGIL 570
                             + +    MS ++L      G+ + +    DEP +ILN KRGI+
Sbjct: 101  VYGFNPDGKALLKKTKNSEEFAAAMSRYELKLAITEGKQVFLYPEKDEPTYILNIKRGII 160

Query: 571  SMIQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEE 630
            S + +  E ++  Q+   + +V+GNCS+  T+       + RK  V TE++       E 
Sbjct: 161  SALLVPPETEEAKQVLFLD-TVYGNCSTHFTI-------KTRKGNVATEIST------ER 206

Query: 631  NMTRWQSFKD---------MVLNMT-VMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSF 680
            ++ +   FK          ++  MT  +   I+SS++C Y L           C+E H F
Sbjct: 207  DLGQCDRFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLF 266

Query: 681  WPMNFNSESGVRTFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTA 740
             P ++ ++ G+   + Q L      ++NS +     ++   L +E        K     A
Sbjct: 267  LPFSYKNKYGMVAQVTQTLKLEDTPKINS-RFFGEGTKKMGLAFESTKSTSPPKE----A 321

Query: 741  DQAMDILKALVKSSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRD 800
            +  +  L+ L K +  E  ++   LF +    L G+++E +  +                
Sbjct: 322  EAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSDEAVTSLL--------------- 366

Query: 801  NPDKEKIAREYLLDGLLPCTTMACFSVKNYAIAKGVVPKPLA-SAWMVTMALQNYPTLEL 859
             P   +++    L  L+ C    C S       K V   PL        +AL   P+ + 
Sbjct: 367  -PQLIEVSSPITLQALVQCGQPQC-STHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQ 424

Query: 860  MSEMLRMAQYSPSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCT 919
            + E+  MA+   S+ T++ LS  V+NY   N       T  + ++    YL   I +DCT
Sbjct: 425  LREIFNMARDQRSRATLYALSHAVNNYHKTNP------TGTQELLDIANYLMEQIQDDCT 478

Query: 920  VSAENERLALVALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQ 979
                +E    + L+ IGN+G+ VE   QLT      +   ++ C ++ +    I KAAIQ
Sbjct: 479  ---GDEDYTYLILRVIGNMGQTVE---QLT----PELKSSILKCIQSTKPSLMIQKAAIQ 528

Query: 980  SMRRFVMSDQLRSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVN 1039
            ++R+    D+   +V+ + F D      +R+AAYL+ M++ PS +++  I   L  E   
Sbjct: 529  ALRKMEPKDK-DQEVLLQTFLDDASPGDKRLAAYLMLMRS-PSQADINKIVQLLPWEQNE 586

Query: 1040 QMKAFCYSHIKNVVESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEP 1099
            Q+K F  SHI N++ S E  +Q+ K  +K A+   +LP    D RK+SR ++L K+++ P
Sbjct: 587  QVKNFVASHIANILNSEELDIQDLKKLVKEALKESQLPTV-MDFRKFSRNYQLYKSVSLP 645

Query: 1100 WRNNTVAAQFESDIIFNPESYLPQEVMFHYVLNALG-KSMDIFETGIEMKGFEPIIESVF 1158
               +  +A+ E ++IF+P +YLP+E M    L A G  S D+ E G+E KGFEP +E++F
Sbjct: 646  -SLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALF 704

Query: 1159 GPEGFFPEVKLQTMFDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMK 1218
            G +GFFP+              ++K   +   Q+ + V+       +V +    Y K  K
Sbjct: 705  GKQGFFPDS-------------VNKALYWVNGQVPDGVS-------KVLVDHFGYTKDDK 744

Query: 1219 RQSSFGEPQVVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLAL 1278
            R+       ++ +  E  +  L              +A  +LR+ G E GF    D+  L
Sbjct: 745  REQDMVNGMMLSI--EKLIKDLKS--------KEVPEARAYLRILGEELGFARLHDLQLL 794

Query: 1279 IPYTMGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAV 1338
                +     L    + I +++ +G   +    ++FM+ +F +PTG G+ L  S +G  V
Sbjct: 795  GKLLLMGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPTGAGLQLQVSSSG--V 852

Query: 1339 VSLRMKSQFSFNLPKIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAG 1398
            ++   K+     +  + A     PS +VE +  MGI +P    +GV  N   +H S L  
Sbjct: 853  IAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQMNTNFFHESGLEA 912

Query: 1399 NITIDGTHLKINLNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTNVSKV 1458
            ++ +    LK  + +  RP+ L +   T +L+      E IP ++++      C  V   
Sbjct: 913  HVALKAGQLKFIIPSPKRPVKLLSAGNTLHLVSTT-KTEVIPPLIENRQSWSVCKQVFP- 970

Query: 1459 FGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQIREGGA 1517
             G++ C S AY NAS    A  +P +G     + L  T + ++ Y++ A Y+  RE  A
Sbjct: 971  -GLNYCTSGAYSNASSTDSASYYPLTGDTRLELELRPTGE-IEQYSVSATYELQREDRA 1027
>ref|XP_515323.2| PREDICTED: apolipoprotein B isoform 3 [Pan troglodytes]
          Length = 4562

 Score =  328 bits (842), Expect = 1e-087
 Identities = 282/1079 (26%), Positives = 488/1079 (45%), Gaps = 123/1079 (11%)

Query: 470  ELTRFKEGYSYTFKYEAETESGIKGAGPGSNMT-MTCDIIIEAPERCRNVLKARRCLLE- 527
            + TRFK    YT+ YEAE+ SG+ G     + T + C + +E P+ C  +LK  +C L+ 
Sbjct: 41   DATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKE 100

Query: 528  -----------------NRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGIL 570
                             + +    MS ++L      G+ + +    DEP +ILN KRGI+
Sbjct: 101  VYGFNPDGKALLKKTKNSEEFAAAMSRYELKLAITEGKQVFLYPEKDEPTYILNIKRGII 160

Query: 571  SMIQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEE 630
            S + +  E ++  Q+   + +V+GNCS+  T+       + RK  V TE++       E 
Sbjct: 161  SALLVPPETEEAKQVLFLD-TVYGNCSTHFTI-------KTRKGNVATEIST------ER 206

Query: 631  NMTRWQSFKD---------MVLNMT-VMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSF 680
            ++ +   FK          ++  MT  +   I+SS++C Y L           C+E H F
Sbjct: 207  DLGQCDRFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLF 266

Query: 681  WPMNFNSESGVRTFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTA 740
             P ++ ++ G+   + Q L      ++NS +     ++   L +E        K     A
Sbjct: 267  LPFSYKNKYGMVAQVTQTLKLEDTPKINS-RFFGEGTKKMGLAFESTKSTSPPKE----A 321

Query: 741  DQAMDILKALVKSSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRD 800
            +  +  L+ L K +  E  ++   LF +    L G+++E +  +                
Sbjct: 322  EAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSDEAVTSLL--------------- 366

Query: 801  NPDKEKIAREYLLDGLLPCTTMACFSVKNYAIAKGVVPKPLA-SAWMVTMALQNYPTLEL 859
             P   +++    L  L+ C    C S       K V   PL        +AL   P+ + 
Sbjct: 367  -PQLIEVSSPITLQALVQCGQPQC-STHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQ 424

Query: 860  MSEMLRMAQYSPSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCT 919
            + E+  MA+   S+ T++ LS  V+NY   N       T  + ++    YL   I +DCT
Sbjct: 425  LREIFNMARDQRSRATLYALSHAVNNYHKTNP------TGTQELLDIANYLMEQIQDDCT 478

Query: 920  VSAENERLALVALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQ 979
                +E    + L+ IGN+G+ VE   QLT      +   ++ C ++ +    I KAAIQ
Sbjct: 479  ---GDEDYTYLILRVIGNMGQTVE---QLT----PELKSSILKCIQSTKPSLMIQKAAIQ 528

Query: 980  SMRRFVMSDQLRSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVN 1039
            ++R+    D+   +V+ + F D      +R+AAYL+ M++ PS +++  I   L  E   
Sbjct: 529  ALRKMEPKDK-DQEVLLQTFLDDASPGDKRLAAYLMLMRS-PSQADINKIVQLLPWEQNE 586

Query: 1040 QMKAFCYSHIKNVVESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEP 1099
            Q+K F  SHI N++ S E  +Q+ K  +K A+   +LP    D RK+SR ++L K+++ P
Sbjct: 587  QVKNFVASHIANILNSEELDIQDLKKLVKEALKESQLPTV-MDFRKFSRNYQLYKSVSLP 645

Query: 1100 WRNNTVAAQFESDIIFNPESYLPQEVMFHYVLNALG-KSMDIFETGIEMKGFEPIIESVF 1158
               +  +A+ E ++IF+P +YLP+E M    L A G  S D+ E G+E KGFEP +E++F
Sbjct: 646  -SLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALF 704

Query: 1159 GPEGFFPEVKLQTMFDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMK 1218
            G +GFFP+              ++K   +   Q+ + V+       +V +    Y K  K
Sbjct: 705  GKQGFFPDS-------------VNKALYWVNGQVPDGVS-------KVLVDHFGYTKDDK 744

Query: 1219 RQSSFGEPQVVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLAL 1278
            R+       ++ +  E  +  L              +A  +LR+ G E GF    D+  L
Sbjct: 745  REQDMVNGMMLSI--EKLIKDLKS--------KEVPEARAYLRILGEELGFARLHDLQLL 794

Query: 1279 IPYTMGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAV 1338
                +     L    + I +++ +G   +    ++FM+ +F +PTG G+ L  S +G  V
Sbjct: 795  GKLLLMGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPTGAGLQLQVSSSG--V 852

Query: 1339 VSLRMKSQFSFNLPKIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAG 1398
            ++   K+     +  + A     PS +VE +  MGI +P    +GV  N   +H S L  
Sbjct: 853  IAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQMNTNFFHESGLEA 912

Query: 1399 NITIDGTHLKINLNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTNVSKV 1458
            ++ +    LK  + +  RP+ L +   T +L+      E IP ++++      C  V   
Sbjct: 913  HVALKAGQLKFIIPSPKRPVKLLSAGNTLHLVSTT-KTEVIPPLIENRQSWSVCKQVFP- 970

Query: 1459 FGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQIREGGA 1517
             G++ C S AY NAS    A  +P +G     + L  T + ++ Y++ A Y+  RE  A
Sbjct: 971  -GLNYCTSGAYSNASSTDSASYYPLTGDTRLELELRPTGE-IEQYSVSATYELQREDRA 1027
>ref|XP_001141877.1| PREDICTED: apolipoprotein B isoform 1 [Pan troglodytes]
          Length = 4544

 Score =  328 bits (842), Expect = 1e-087
 Identities = 282/1079 (26%), Positives = 488/1079 (45%), Gaps = 123/1079 (11%)

Query: 470  ELTRFKEGYSYTFKYEAETESGIKGAGPGSNMT-MTCDIIIEAPERCRNVLKARRCLLE- 527
            + TRFK    YT+ YEAE+ SG+ G     + T + C + +E P+ C  +LK  +C L+ 
Sbjct: 41   DATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKE 100

Query: 528  -----------------NRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGIL 570
                             + +    MS ++L      G+ + +    DEP +ILN KRGI+
Sbjct: 101  VYGFNPDGKALLKKTKNSEEFAAAMSRYELKLAITEGKQVFLYPEKDEPTYILNIKRGII 160

Query: 571  SMIQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEE 630
            S + +  E ++  Q+   + +V+GNCS+  T+       + RK  V TE++       E 
Sbjct: 161  SALLVPPETEEAKQVLFLD-TVYGNCSTHFTI-------KTRKGNVATEIST------ER 206

Query: 631  NMTRWQSFKD---------MVLNMT-VMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSF 680
            ++ +   FK          ++  MT  +   I+SS++C Y L           C+E H F
Sbjct: 207  DLGQCDRFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTLDAKRKHVAEAICKEQHLF 266

Query: 681  WPMNFNSESGVRTFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTA 740
             P ++ ++ G+   + Q L      ++NS +     ++   L +E        K     A
Sbjct: 267  LPFSYKNKYGMVAQVTQTLKLEDTPKINS-RFFGEGTKKMGLAFESTKSTSPPKE----A 321

Query: 741  DQAMDILKALVKSSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRD 800
            +  +  L+ L K +  E  ++   LF +    L G+++E +  +                
Sbjct: 322  EAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSDEAVTSLL--------------- 366

Query: 801  NPDKEKIAREYLLDGLLPCTTMACFSVKNYAIAKGVVPKPLA-SAWMVTMALQNYPTLEL 859
             P   +++    L  L+ C    C S       K V   PL        +AL   P+ + 
Sbjct: 367  -PQLIEVSSPITLQALVQCGQPQC-STHILQWLKRVHANPLLIDVVTYLVALIPEPSAQQ 424

Query: 860  MSEMLRMAQYSPSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCT 919
            + E+  MA+   S+ T++ LS  V+NY   N       T  + ++    YL   I +DCT
Sbjct: 425  LREIFNMARDQRSRATLYALSHAVNNYHKTNP------TGTQELLDIANYLMEQIQDDCT 478

Query: 920  VSAENERLALVALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQ 979
                +E    + L+ IGN+G+ VE   QLT      +   ++ C ++ +    I KAAIQ
Sbjct: 479  ---GDEDYTYLILRVIGNMGQTVE---QLT----PELKSSILKCIQSTKPSLMIQKAAIQ 528

Query: 980  SMRRFVMSDQLRSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVN 1039
            ++R+    D+   +V+ + F D      +R+AAYL+ M++ PS +++  I   L  E   
Sbjct: 529  ALRKMEPKDK-DQEVLLQTFLDDASPGDKRLAAYLMLMRS-PSQADINKIVQLLPWEQNE 586

Query: 1040 QMKAFCYSHIKNVVESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEP 1099
            Q+K F  SHI N++ S E  +Q+ K  +K A+   +LP    D RK+SR ++L K+++ P
Sbjct: 587  QVKNFVASHIANILNSEELDIQDLKKLVKEALKESQLPTV-MDFRKFSRNYQLYKSVSLP 645

Query: 1100 WRNNTVAAQFESDIIFNPESYLPQEVMFHYVLNALG-KSMDIFETGIEMKGFEPIIESVF 1158
               +  +A+ E ++IF+P +YLP+E M    L A G  S D+ E G+E KGFEP +E++F
Sbjct: 646  -SLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALF 704

Query: 1159 GPEGFFPEVKLQTMFDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMK 1218
            G +GFFP+              ++K   +   Q+ + V+       +V +    Y K  K
Sbjct: 705  GKQGFFPDS-------------VNKALYWVNGQVPDGVS-------KVLVDHFGYTKDDK 744

Query: 1219 RQSSFGEPQVVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLAL 1278
            R+       ++ +  E  +  L              +A  +LR+ G E GF    D+  L
Sbjct: 745  REQDMVNGMMLSI--EKLIKDLKS--------KEVPEARAYLRILGEELGFARLHDLQLL 794

Query: 1279 IPYTMGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAV 1338
                +     L    + I +++ +G   +    ++FM+ +F +PTG G+ L  S +G  V
Sbjct: 795  GKLLLMGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPTGAGLQLQVSSSG--V 852

Query: 1339 VSLRMKSQFSFNLPKIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAG 1398
            ++   K+     +  + A     PS +VE +  MGI +P    +GV  N   +H S L  
Sbjct: 853  IAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQMNTNFFHESGLEA 912

Query: 1399 NITIDGTHLKINLNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTNVSKV 1458
            ++ +    LK  + +  RP+ L +   T +L+      E IP ++++      C  V   
Sbjct: 913  HVALKAGQLKFIIPSPKRPVKLLSAGNTLHLVSTT-KTEVIPPLIENRQSWSVCKQVFP- 970

Query: 1459 FGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQIREGGA 1517
             G++ C S AY NAS    A  +P +G     + L  T + ++ Y++ A Y+  RE  A
Sbjct: 971  -GLNYCTSGAYSNASSTDSASYYPLTGDTRLELELRPTGE-IEQYSVSATYELQREDRA 1027
>ref|NP_000375.2| apolipoprotein B precursor [Homo sapiens]
          Length = 4563

 Score =  328 bits (841), Expect = 1e-087
 Identities = 287/1097 (26%), Positives = 497/1097 (45%), Gaps = 126/1097 (11%)

Query: 455  GTRFGQEVVPELEC---SELTRFKEGYSYTFKYEAETESGIKGAGPGSNMT-MTCDIIIE 510
            G R  +E++  +      + TRFK    YT+ YEAE+ SG+ G     + T + C + +E
Sbjct: 24   GARAEEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELE 83

Query: 511  APERCRNVLKARRCLLE------------------NRDLDEEMSAHDLVFRTQNGRIIEV 552
             P+ C  +LK  +C L+                  + +    MS ++L      G+ + +
Sbjct: 84   VPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFL 143

Query: 553  LAHPDEPLHILNAKRGILSMIQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPR 612
                DEP +ILN KRGI+S + +  E ++  Q+   + +V+GNCS+  TV       + R
Sbjct: 144  YPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLD-TVYGNCSTHFTV-------KTR 195

Query: 613  KLQVVTELNNCMLRKQEENMTRWQSFKD---------MVLNMT-VMDKFINSSKTCSYDL 662
            K  V TE++       E ++ +   FK          ++  MT  +   I+SS++C Y L
Sbjct: 196  KGNVATEIST------ERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTL 249

Query: 663  KGTTGEFRGIQCEEVHSFWPMNFNSESGVRTFIQQRLISTAIDRLNSYKVDPANSRSTCL 722
                       C+E H F P ++ ++ G+   + Q L      ++NS +     ++   L
Sbjct: 250  DAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINS-RFFGEGTKKMGL 308

Query: 723  RYEHDPKEIGKKADDVTADQAMDILKALVKSSREEVQMESPRLFGRWRAALEGMNNETIH 782
             +E        K     A+  +  L+ L K +  E  ++   LF +    L G+++E + 
Sbjct: 309  AFESTKSTSPPKQ----AEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSDEAVT 364

Query: 783  EVFDRAYNCSAYSQTCRDNPDKEKIAREYLLDGLLPCTTMACFSVKNYAIAKGVVPKPLA 842
             +                 P   +++    L  L+ C    C S       K V   PL 
Sbjct: 365  SLL----------------PQLIEVSSPITLQALVQCGQPQC-STHILQWLKRVHANPLL 407

Query: 843  -SAWMVTMALQNYPTLELMSEMLRMAQYSPSQITIFPLSIMVHNYWMNNEEIHTAATLPE 901
                   +AL   P+ + + E+  MA+   S+ T++ LS  V+NY   N       T  +
Sbjct: 408  IDVVTYLVALIPEPSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNP------TGTQ 461

Query: 902  PIVKTIRYLKSLIGNDCTVSAENERLALVALKAIGNIGEPVERYDQLTFIFSERVSPVLI 961
             ++    YL   I +DCT    +E    + L+ IGN+G+ +E   QLT      +   ++
Sbjct: 462  ELLDIANYLMEQIQDDCT---GDEDYTYLILRVIGNMGQTME---QLT----PELKSSIL 511

Query: 962  SCTKNKQIPRDISKAAIQSMRRFVMSDQLRSQVISELFKDTTLDVPQRIAAYLITMKANP 1021
             C ++ +    I KAAIQ++R+    D+   +V+ + F D      +R+AAYL+ M++ P
Sbjct: 512  KCVQSTKPSLMIQKAAIQALRKMEPKDK-DQEVLLQTFLDDASPGDKRLAAYLMLMRS-P 569

Query: 1022 SVSELTDIWNFLKTEPVNQMKAFCYSHIKNVVESSEPTLQEFKMNLKIAMDGEELPEYPK 1081
            S +++  I   L  E   Q+K F  SHI N++ S E  +Q+ K  +K A+   +LP    
Sbjct: 570  SQADINKIVQILPWEQNEQVKNFVASHIANILNSEELDIQDLKKLVKEALKESQLPTV-M 628

Query: 1082 DIRKYSRFFELSKNLTEPWRNNTVAAQFESDIIFNPESYLPQEVMFHYVLNALG-KSMDI 1140
            D RK+SR ++L K+++ P   +  +A+ E ++IF+P +YLP+E M    L A G  S D+
Sbjct: 629  DFRKFSRNYQLYKSVSLP-SLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADL 687

Query: 1141 FETGIEMKGFEPIIESVFGPEGFFPEVKLQTMFDTIDEKILSKVREFAEAQLGNWVTPTS 1200
             E G+E KGFEP +E++FG +GFFP+              ++K   +   Q+ + V+   
Sbjct: 688  IEIGLEGKGFEPTLEALFGKQGFFPD-------------SVNKALYWVNGQVPDGVSKVL 734

Query: 1201 EPDNEVFIKKDKYGKKMKRQSSFGEPQVVDVIHENTMNKLNQLHYLVGMEPSATDATVFL 1260
              D+  + K DK+           E  +V+ I  +    +  L           +A  +L
Sbjct: 735  -VDHFGYTKDDKH-----------EQDMVNGIMLSVEKLIKDL-----KSKEVPEARAYL 777

Query: 1261 RLFGNEFGFVSASDVLALIPYTMGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFI 1320
            R+ G E GF S  D+  L    +     L    + I +++ +G   +    ++FM+ +F 
Sbjct: 778  RILGEELGFASLHDLQLLGKLLLMGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFE 837

Query: 1321 VPTGMGMPLNCSINGTAVVSLRMKSQFSFNLPKIIAAGHVAPSGAVEVLATMGIGMPTKV 1380
            +PTG G+ L  S +G  V++   K+     +  + A     PS +VE +  MGI +P   
Sbjct: 838  LPTGAGLQLQISSSG--VIAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFA 895

Query: 1381 FTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLKANGDIEFIP 1440
             +GV  N   +H S L  ++ +    LK  + +  RP+ L +   T +L+      E IP
Sbjct: 896  RSGVQMNTNFFHESGLEAHVALKAGKLKFIIPSPKRPVKLLSGGNTLHLVSTT-KTEVIP 954

Query: 1441 GVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNVTLVNTDQAL 1500
             ++++      C  V    G++ C S AY NAS    A  +P +G     + L  T + +
Sbjct: 955  PLIENRQSWSVCKQVFP--GLNYCTSGAYSNASSTDSASYYPLTGDTRLELELRPTGE-I 1011

Query: 1501 KAYTIDAQYKQIREGGA 1517
            + Y++ A Y+  RE  A
Sbjct: 1012 EQYSVSATYELQREDRA 1028
>ref|XP_001182866.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
          Length = 127

 Score =  262 bits (670), Expect = 1e-067
 Identities = 127/127 (100%), Positives = 127/127 (100%)

Query: 1   MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 60
           MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK
Sbjct: 1   MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 60

Query: 61  ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV 120
           ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV
Sbjct: 61  ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV 120

Query: 121 TLVNTDQ 127
           TLVNTDQ
Sbjct: 121 TLVNTDQ 127

 Score =  262 bits (670), Expect = 1e-067
 Identities = 127/127 (100%), Positives = 127/127 (100%)

Query: 1372 MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 1431
            MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK
Sbjct: 1    MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 60

Query: 1432 ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV 1491
            ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV
Sbjct: 61   ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV 120

Query: 1492 TLVNTDQ 1498
            TLVNTDQ
Sbjct: 121  TLVNTDQ 127
>ref|XP_001193875.1| PREDICTED: hypothetical protein, partial [Strongylocentrotus
           purpuratus]
          Length = 126

 Score =  260 bits (665), Expect = 4e-067
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 60
           MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK
Sbjct: 1   MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 60

Query: 61  ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV 120
           ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV
Sbjct: 61  ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV 120

Query: 121 TLVNTD 126
           TLVNTD
Sbjct: 121 TLVNTD 126

 Score =  260 bits (665), Expect = 4e-067
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1372 MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 1431
            MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK
Sbjct: 1    MGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLK 60

Query: 1432 ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV 1491
            ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV
Sbjct: 61   ANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSFNV 120

Query: 1492 TLVNTD 1497
            TLVNTD
Sbjct: 121  TLVNTD 126
>ref|XP_971721.1| PREDICTED: similar to CG15828-PB, isoform B [Tribolium castaneum]
          Length = 4119

 Score =  259 bits (662), Expect = 8e-067
 Identities = 241/999 (24%), Positives = 446/999 (44%), Gaps = 120/999 (12%)

Query: 528  NRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGILSMIQLDLEADDVDQITL 587
            +++  + +S H L F   +G I E+    DE   +LN KRGILSM    ++  D+D  T 
Sbjct: 102  SQEFSDMISEHTLRFSFNDGIISEICPQDDEKNWVLNFKRGILSMFHNTMKRFDLDHSTT 161

Query: 588  NEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENMTRWQSFKDMVLNMTV 647
             E  V G C ++ TV  R  K+    L+   +L+ C  R +  +M +      +  N   
Sbjct: 162  EE-DVRGQCPTQYTV--RGAKETSLILEKTKDLHGCKKRAKLHSMVQ-----SVPYNFRP 213

Query: 648  MDK-FINSSKTCSYDLKGTTGEFRGIQCEEVHSFWPMNFNSESGVRTFIQQRLISTAIDR 706
             +K  + SS  C   +      +  I CEE H   P + N ++G  T ++QRLI    + 
Sbjct: 214  EEKNLLKSSSRCQMSIDHNI--YNEITCEESHVLQPFS-NQDAGATTIVEQRLILLGENA 270

Query: 707  LNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTADQAMDILKALVKSSREEVQMESPRLF 766
            +   +     SR T L ++H P     K        + D++K + K   ++VQ+E   LF
Sbjct: 271  VTLGEQSEL-SRRTSLLFDHVPSP---KPTHDKLIASRDLIKKMCKQGTDDVQIEFSDLF 326

Query: 767  GRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIAREYLLDGLLPCTTMACFS 826
             ++   L  ++  ++  ++  A        TC          ++++LD L    + A  +
Sbjct: 327  TKFIQTLRLLSYPSLSTLYGHA------GATC-------PTGKKHILDALPYVGSAASVT 373

Query: 827  VKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQYSPSQITI-FPLSIMVHN 885
            +    I K  VP+     WM+++A    P   +M     + Q  P   +I F ++ + H 
Sbjct: 374  LMKDIILKRGVPESTIKDWMMSLAFIPRPDDGMMEAAAALLQQKPFDASIAFSVTALTHT 433

Query: 886  YWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSAENERLALVALKAIGNIGEPVERY 945
            Y     +      +   + K    +  L G+      E+    +VALK++GNIG      
Sbjct: 434  YCSQRSDCIETNVVNAIVDKMENTIIGLYGSK-QFDRESRDKIIVALKSLGNIG------ 486

Query: 946  DQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQLRSQVISELFKDTTLD 1005
                 + S+ +   L+S  ++ +I   I  AA++  RR    +         LF++   D
Sbjct: 487  -----VVSDSIKSYLVSIIEDSKIDAAIRLAAVEVYRRLPCPES--RDYFESLFRNQDED 539

Query: 1006 VPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIKNVVESSEPTLQEFKM 1065
            V  RIA+YL  M+  P+   +  + + L++E VNQ+ +F +SH+ N+++SS P+  E + 
Sbjct: 540  VEVRIASYLQIMRC-PNYLMIRTVKHSLESEEVNQVGSFVWSHLNNLMKSSIPSRVEIQG 598

Query: 1066 NLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFESDIIFNPESYLPQEV 1125
             L    D   + ++  D+RK+S   E S    E      V A ++ ++IF+P SY+P+  
Sbjct: 599  LLS---DLNLVKKFSSDVRKFSHHREGSVFFDE----YNVGANYDGNVIFSPSSYVPRTA 651

Query: 1126 MFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQTMFDTIDEKILSKVR 1185
            M +  ++  G+S+++ E    ++GFE  +ES+FGP+G     K       + EKI SKVR
Sbjct: 652  MLNLTVDVFGQSINLMEVYGRLEGFENYLESMFGPKGPLNSEK-------VKEKIASKVR 704

Query: 1186 EFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQSSFGEPQVVDVIHENTMNKLNQLHY 1245
                          S P+NEV +K +        ++S G+P+V                 
Sbjct: 705  -----------FSRSAPENEV-LKSEIDRLPNVMENSVGDPKV----------------- 735

Query: 1246 LVGMEPSATDATVFLRLFGNEFGFVS---ASDVLALIPYTMGIYEELLNKTKQIPQLLSQ 1302
                       ++ L++FGNE  + +     ++ A +          LN    + ++LS 
Sbjct: 736  -----------SLGLKVFGNELKYATFDGDEEIKAAL--------RTLNPVDHLKRILS- 775

Query: 1303 GLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLRMKSQFS----FNLPKIIAAG 1358
            G  +N  ++ +F+D +++VP+G G+P++ +  GTA ++L++             ++    
Sbjct: 776  GKEINYNKAAMFLDSNYVVPSGAGLPISLNALGTASINLKLFGSLHATNFIKTKELDLKA 835

Query: 1359 HVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTHL-KINLNNTDRP 1417
            ++ PS ++++   M +       TG+   +++Y SS + G+I I G  L  +  +   + 
Sbjct: 836  NIRPSISLDLTGVMTVD-AFYATTGIKLKSSMYTSSAIEGDIKIRGFKLVSVQFSIPRQT 894

Query: 1418 MNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCT--NVSKVFGVDLCVSWAYPNASYV 1475
              +F   +   ++K N + +   G  +  V    C+   V K  G+ LC  + + N + +
Sbjct: 895  SEIFGVKSEVIVMKRNVE-QVQSGPSEHRVSKSICSWPAVDKTVGLKLCGEYHFINVTKI 953

Query: 1476 AEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQIRE 1514
             +AP F  +GP    + L  +D   K Y  + ++   R+
Sbjct: 954  NKAPYFVLAGPAGLRLFLEKSDPTAKTYIFEYKWTDKRD 992
>ref|NP_001025233.1| hypothetical protein LOC321166 [Danio rerio]
          Length = 3730

 Score =  256 bits (653), Expect = 9e-066
 Identities = 259/1065 (24%), Positives = 445/1065 (41%), Gaps = 135/1065 (12%)

Query: 473  RFKEGYSYTFKYEAETESGIKGAGPGSNMTMTCDIIIEAPERCRNVLKARRCLLENR-DL 531
            RFK    Y + YE E+ + + GA  G      C + IE P  C  ++    C L +  D+
Sbjct: 22   RFKSFQKYEYTYETESLNALNGAINGPKAR--CKVEIEVPRICSYIVHTTECELSDVIDV 79

Query: 532  DEE-----------------MSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGILSMIQ 574
            D E                 M+ + L F  +    I++    DEP +ILN KRG++S + 
Sbjct: 80   DAEGKPIFMSSAGAEAFKAAMAKNPLKFTVEGDNDIKLFPENDEPANILNFKRGLISALA 139

Query: 575  LDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENMTR 634
              +  +D ++      +V+G C ++ +V  R D        + T++   +L +   N  +
Sbjct: 140  APVLEEDRNR---RMPTVYGMCRTDYSVNARQD--------IATDV---VLNRDLSNCDK 185

Query: 635  WQSFKDMVLNMTVMD-------KFINSSKTCSYDLKGTTGEFRGIQCEEVHSFWPMNFNS 687
            +   KD    + ++        + I SS+TC+Y             C E H   P ++  
Sbjct: 186  FSPVKDHTSPLALITGMQYPLAQLIRSSQTCNYKFDNDQKHMTSASCSEKHMLLPFSYKG 245

Query: 688  ESGVRTFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTADQAMDIL 747
            E GV    +Q L    +   N    D   +    L  +          D V   Q  D +
Sbjct: 246  EHGVSNVGKQALTLVGVSVYNGRIFDHNEANMKTLHLDDS-------IDSVHPIQDKDAI 298

Query: 748  KALVKSSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKI 807
             ++++   +  +  +    G  RA L      TI ++   + + +         P+  +I
Sbjct: 299  LSILRDLNDLSETTN----GENRAHLAHKLISTIRKMSAESLSAAL--------PEALEI 346

Query: 808  AREYLLDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMA 867
            +R  +   L  C T  C S     +           A +  M +   P+ +L+ EML MA
Sbjct: 347  SRPLVYQALFQCGTPECTSAILRVLRTFDRSSVEIDAAVYAMGMVPNPSRDLVEEMLEMA 406

Query: 868  QYSPSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIR-YLKSLIGNDCTVSAENER 926
            ++  S+   + LS  V   +    E+  + T   P +K +  Y    IG DCT + E+  
Sbjct: 407  KFKSSKPIYYALSNAVKRLY----EVEKSVT---PEIKAVADYTLEQIG-DCTGNQEHVY 458

Query: 927  LALVALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVM 986
            L+L   + IGN+   V          S  +   +I C        ++ +AAIQ  R   +
Sbjct: 459  LSL---RVIGNMAAAVGAA-------SPALKSAVIQCINQPAASPEVQQAAIQVFRLTSV 508

Query: 987  SDQLRSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCY 1046
             D+ R  ++  +F D    + +R+AAYLI MK +P  +EL  +   L      Q  +F  
Sbjct: 509  PDEGREVLMKVIF-DKAAPIQKRVAAYLIVMK-DPQPTELAQLVAALPNNKNCQAMSFVN 566

Query: 1047 SHIKNVVESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVA 1106
            SH++N++ S+     E ++ +  A+ G E+     D  K+SR +++              
Sbjct: 567  SHLRNILSSTTSETGELRVKILNALQGNEIST-STDPTKFSRNYKIGS------------ 613

Query: 1107 AQFESDIIFNPESYLPQEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPE 1166
               E ++IF  E  LP EV+    LNA G  +D+FE G+  KG EP ++++ G +GFF +
Sbjct: 614  --LEGNVIFESEELLPNEVILEMTLNAFGYDVDMFEIGLNGKGLEPTVDALIGIDGFFRD 671

Query: 1167 VKLQTMFDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQSSFGEP 1226
               +T+    D           +   GN +  +  P     IK  K             P
Sbjct: 672  TMQKTINYAAD-----------KVPRGNDIMQSMFPTLWNNIKMQK------------AP 708

Query: 1227 QVVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLALIPYTMGIY 1286
            Q +     N +NKL Q    V   P   +A ++LRL G E G++  +DV  +      + 
Sbjct: 709  QSIVKEITNNVNKLIQ-KLKVQDNP---EAMIYLRLLGAEMGYLKTNDVEDMAYSAALLT 764

Query: 1287 EELLNK-TKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLRMKS 1345
            + LLN       + L   +N N    +VFMD  F +PTG G+PL  +++GT    ++   
Sbjct: 765  KSLLNMFPTDFLRNLYSSVNNNLFLHYVFMDNEFYLPTGTGIPLRVALSGTFAPGVKGGL 824

Query: 1346 QFSFNLPKIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGNITIDGT 1405
            + + ++ ++       PS  VE +  +G  +P  V +G+  +  +YH S L   + +   
Sbjct: 825  KLARDMSEVA----FMPSAGVEFVTEVGALLPEYVESGLEMHTNIYHESGLKVKVAVTNK 880

Query: 1406 HLKINLNNTDRPMNLFNYSTTYNLLKANG-DIEFIPGVLQDAVQSQRCTNVSKVFGVDLC 1464
              K+ +        L + S   +L    G +I+ IP  L + V++++CT    + G   C
Sbjct: 881  QFKLTIPTPKTSTKLISVSN--SLYSVTGTEIKRIP-PLAEHVKARKCTPF--IPGFQYC 935

Query: 1465 VSWAYPNASYVAEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQY 1509
                Y NA     AP FP +G + F + +  T + + +YT  A Y
Sbjct: 936  GVMQYSNAFSNDAAPYFPLTGDSKFAIEIHPTGE-VSSYTATADY 979
>ref|XP_583646.3| PREDICTED: similar to apolipoprotein B, partial [Bos taurus]
          Length = 638

 Score =  234 bits (598), Expect = 2e-059
 Identities = 184/696 (26%), Positives = 324/696 (46%), Gaps = 86/696 (12%)

Query: 648  MDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSFWPMNFNSESGVRTFIQQRLISTAIDRL 707
            +   I SS++C Y L           C E H F P ++ ++ G+   + Q L      ++
Sbjct: 5    LSTLIGSSQSCRYTLDPRKKHVSEAICNEQHLFLPFSYKNKYGMMAQVTQTLKLENTPKI 64

Query: 708  NSYKVDPANSRSTCLRYEHDPKEIGKKADDVTADQAMDILKALVKSSRE-------EVQM 760
            NS              +E   + +G   +   +    +  +A+VK+ +E       E   
Sbjct: 65   NSRF------------FEEGTEAVGLAFESTRSTSPPNHAEAIVKTLQELQKLHVSEQNA 112

Query: 761  ESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIAREYLLDGLLPCT 820
            +   LF +    L G+++E +  +                 P   +++    L  L+ C 
Sbjct: 113  QRANLFHKLVTELRGLSSEAVTSLL----------------PKLIEVSSPITLQALIQCG 156

Query: 821  TMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQYSPSQITIFPLS 880
               C++     +        L  A    +AL   P+ E + E+   A+   S++T + LS
Sbjct: 157  QPQCYTHILQWLKNERANPLLIDAVTYLVALIPEPSAERLREVFNTARVQQSRLTFYALS 216

Query: 881  IMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSAENERLALVALKAIGNIGE 940
             M++NY   N       T  + +++   YL   IGNDCT    NE L  + L+ IGNIG+
Sbjct: 217  HMINNYHKTNP------TWTQDLLEIADYLSEQIGNDCT---GNEDLTYLILRVIGNIGK 267

Query: 941  PVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQLRSQVISELFK 1000
             +E   QLT     +++  ++ C +++Q    I KAAIQ++R+  +SD++R +V+ + F 
Sbjct: 268  TME---QLT----PKLTSSVLKCIRSEQPSLVIQKAAIQALRKMELSDEVR-EVLLQTFL 319

Query: 1001 DTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIKNVVESSEPTL 1060
            D T    +R+AAYL+ M  +PS S+++ I   L  E   Q+K F  SHI N++ S +  +
Sbjct: 320  DDTSPGDKRLAAYLMLM-GSPSQSDISKITQLLSGEQNEQVKNFVASHIANILNSEDLYV 378

Query: 1061 QEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFESDIIFNPESY 1120
            Q+ K  ++ A+   +LP    D +K+SR ++ SK+++ P   + V+A+ E ++IF+P +Y
Sbjct: 379  QDLKSLVEEALKKSQLPTI-MDFKKFSRSYQFSKSISLP-SLDLVSAKIEGNLIFDPNNY 436

Query: 1121 LPQEVMFHYVLNALG-KSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQTMFDTIDEK 1179
            LP+E M    L   G  S D+FE G+E KGFEP +E++FG EGFFP+   + ++  ++ +
Sbjct: 437  LPKESMLKTTLKVFGFASADLFEIGLEGKGFEPTLEALFGKEGFFPDSVNKALY-WVNGR 495

Query: 1180 ILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQSSFGEPQVVDVIHENTMNK 1239
            +  +V +      G             + K DK+ + M     F   ++V  +       
Sbjct: 496  VPDRVSKVLVDHFG-------------YTKDDKHEQDMVNGVMFNVEKLVKDLKSKDF-- 540

Query: 1240 LNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLALIPYTMGIYEELLNKTKQIPQL 1299
                           +A  +LR+ G E GFV   D+  L    +     L    + I +L
Sbjct: 541  --------------PEARAYLRILGEELGFVKLHDLQLLGKLLLKGVRTLQGIPQMIKEL 586

Query: 1300 LSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSING 1335
            + +G   +    ++FMD +F +PTG+G+ L  S +G
Sbjct: 587  IRKGSTSDLFLHYIFMDNAFELPTGLGLQLQVSSSG 622
>ref|XP_001237622.1| ENSANGP00000018828 [Anopheles gambiae str. PEST]
          Length = 4258

 Score =  209 bits (531), Expect = 1e-051
 Identities = 240/1080 (22%), Positives = 467/1080 (43%), Gaps = 150/1080 (13%)

Query: 533  EEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGILSMIQLDLEADDVDQITLNEVSV 592
            EE+   +L F   +G I E+     E +  LN KRGILS +Q  +   D+D  T  E  V
Sbjct: 117  EELMRFELRFAFHDGAIGEICHEDSESVWTLNLKRGILSALQNTMPRFDIDYDT-TETDV 175

Query: 593  HGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENMTRWQSFKDMVLNMTVMDKF- 651
             G C  +     R+               + + RK ++ ++  + +K      TV   F 
Sbjct: 176  SGICDVQYKTNGRNG-------------TSLLFRKTKDLVSCKRRYKTTSFIQTVPYDFR 222

Query: 652  --------INSSKTCSYDLKGTTGEFRGIQCEEVHSFWPMNFNSESGVRTFIQQRL-IST 702
                    +NS+  C + +  +   ++ + C E H   P + N  +G  T    RL ++ 
Sbjct: 223  TNYVAWPILNSNSYCDFSIDNSI--YKSVACYERHQLVPFS-NGLAGAVTETYNRLELAD 279

Query: 703  AIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTADQAMDILKALVKSSREEVQMES 762
                ++    +    R + L Y+H P  + +  D++ A +  ++L  L       ++ + 
Sbjct: 280  EETYVHEGNNEIDIQRRSSLLYDHTPS-VHESHDEIKASR--ELLMELCVHGFPNIRRDF 336

Query: 763  PRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIAREYLLDGLLPCTTM 822
            P +F ++  A   +++  ++++  R       S+   DN  K      ++L+ L    + 
Sbjct: 337  PDVFLKFLTAARALSSNALYQLLTR-------SRAICDNGHK------HILESLPYIGSA 383

Query: 823  ACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQ---------YSPSQ 873
            A  ++    I +  V   LA+ WM + A    P  E++  ML++ +         Y  S 
Sbjct: 384  ASVTLMKDQIVENNVGPALANKWMESFAFLTRPNEEVLEAMLQLMKHGKESGDQTYLLSG 443

Query: 874  ITIFPLSIMVHNYWMNNEEIHTAAT-LPEPIVKTIRYLKSLIGNDCTVSAENERLALVAL 932
             T+      +H+    +E +      L E ++ TI+  +S + +D     + ER+ +V L
Sbjct: 444  STVVNTFCKIHSNCGESEAVQAIVQYLEEELLDTIQSAESKLQHD---RRKRERV-IVLL 499

Query: 933  KAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQLRS 992
             ++GN+G           + ++R++  L +  ++++ P ++   A+   RR   SD  R+
Sbjct: 500  MSLGNMG-----------VVNKRLNFELRTIIESERYPTEVRVEAVNVFRR---SDCTRT 545

Query: 993  Q-VISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIKN 1051
            +    +L+    LDV  RIAAYL  M+  P    +  I N LKTE V Q+ +F +SH+ N
Sbjct: 546  KDYFLKLYSTFLLDVEVRIAAYLQAMRC-PDHLSVRLIKNVLKTEEVKQVGSFVWSHLTN 604

Query: 1052 VVESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFES 1111
            + +S+ P   + +    +  + +   ++  DIRK+SR +E +    E     TV    +S
Sbjct: 605  LAKSASPVRVQAQ---GLLAENDLDSKFNLDIRKFSRNYEQTLFFDEYNFGMTV----DS 657

Query: 1112 DIIFNPESYLPQEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQT 1171
            ++IF+ ESY+P+ +  +   +  G+S++  E  + ++G E  +  +FGP G +   K+  
Sbjct: 658  NVIFSTESYVPRSLRLNLTTDLFGESINFLELNVRLEGLEQSVHHLFGPNGTYSAKKVGE 717

Query: 1172 MFDT----IDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQSSFGEPQ 1227
              DT    + + + +KV E  + +       +S  D     +++  GK+   Q      +
Sbjct: 718  RVDTYMKFLRQYVPTKVLELFDGE-------SSWRDELQDAEENGRGKRAAVQ------R 764

Query: 1228 VVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLALIPYTMGIYE 1287
            +  +I       +++L + +         T+ +++FGN+  +           YT G+  
Sbjct: 765  LPVLIARQIQEDVDRLGFHLKGNFDKPQVTIGVKIFGNDLNY-----------YTDGL-- 811

Query: 1288 ELLNKTKQIPQLLS--QGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLRMKS 1345
            E+ +K  Q  +L S   G   + T+S VF+D S+ VP   GMPL   + G + V LR+  
Sbjct: 812  EIFSKVNQRKKLASLFDGKESSYTKSSVFLDTSYDVPLSSGMPLALGLVGASSVDLRLTG 871

Query: 1346 Q---FSFNLPKIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGNITI 1402
            +   F +    I   G + PS  +++ A+M   +     T +     +Y +S  A ++ +
Sbjct: 872  KIRAFDYTRWLIDIEGKLKPSITMDITASMRSDL-MHASTAIKEKTNLYSNSAWAAHLKL 930

Query: 1403 DGTHLKINLNNTDRPMN-LFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCT--NVSKVF 1459
             GT   +   +  +  N +F+  +   +L    +++     ++    +  CT   + +  
Sbjct: 931  RGTDQAVLQVSLPQERNDIFSIRSEMFVLTERRELQ--QAGIERRYSNSTCTWPFIDQAI 988

Query: 1460 GVDLCVSWAYPNASYV---AEAPRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQIREGG 1516
            G+ +C +++ P+ S      E P    SGP +F+V+L  TD   K + +   +       
Sbjct: 989  GLKMCTNYSLPDVSNTGKDVEVPSLILSGPVNFDVSLEKTDPTAKMFVLKYSW------- 1041

Query: 1517 APAPMPFKSIGKRSTQNAPAFTKLIDTVRVSFYAPGEELTRNITSLVSVDRLRKTAKWTF 1576
                       +R  Q           V V F  P  ++ R   + ++ +  RKTA  +F
Sbjct: 1042 ----------AERQNQT---------IVGVVFETPNSQIPRIFRANITNEVQRKTASMSF 1082
>ref|XP_394269.3| PREDICTED: similar to CG15828-PB, isoform B [Apis mellifera]
          Length = 4262

 Score =  194 bits (493), Expect = 3e-047
 Identities = 238/1060 (22%), Positives = 440/1060 (41%), Gaps = 181/1060 (17%)

Query: 496  GPGSNMTMTCDIIIEAPERCRNVLKARRCLLEN--------------RDLDEEMSAHDLV 541
            G  S + +  D++I    RC   L+     L +               D    +    L 
Sbjct: 49   GNESTLRLDADLLIRFNGRCEGSLRFENASLSHDRRKYNPEFPDRAGADFKVNLERFPLR 108

Query: 542  FRTQNGRIIEVLAHPDEPLHILNAKRGILSMIQLDLEADDVDQITLNEVSVHGNCSSEMT 601
            F   +G+I E+     EP+  LN KRG+LS+ Q  +E  DVD+  + EV V+G C +   
Sbjct: 109  FTFDDGQIDELCPDKREPIWALNLKRGVLSLFQNTMERFDVDRHAI-EVDVNGICDTSYH 167

Query: 602  VTRRDDKQRPRKLQVVTELNNCMLRKQEENMTRWQSFKDMVLNMTVMDKFINSSKTCSYD 661
                  K+    ++   +L+NC    +  ++ R  S+K     +     F  S   C   
Sbjct: 168  F--HGAKRTSLIVKKKKDLSNCDHGSKYFSVIRSNSYKSPRSRIPRHPLFA-SHVECELT 224

Query: 662  LKGTTGEFRGIQCEEVHSFWPMNFNSESGVRTFIQQRLISTAIDRLNSYKVDPANSRSTC 721
            +      +  I C+E H   P++ + ++G RT       STA  RL              
Sbjct: 225  IDRKI--YEKITCKESHRLLPLS-SGDTGARTE------STATLRL-------------- 261

Query: 722  LRYEHDPKEIGKKADDVTAD---QAMDILKALVKSSREEVQMESPRLFGRWRAALEGMNN 778
                     I +  DD   D   +A D     +  S +E++      F  +  +   ++ 
Sbjct: 262  ---------IEESRDDHGFDDGYEASDEYGTELGISMDELEQRFSETFTAFIQSARYLDY 312

Query: 779  ETIHEVFDRAYNCSAYSQTCRDNPDKEKIAREYLLDGLLPCTTMACFSVKNYAIAKGVVP 838
             ++ ++F RA                 K  + ++++ L    + A  +V    + K  V 
Sbjct: 313  PSLSQLFARADGIC-------------KTGKRHIVNALPFIGSNAALNVMRDLMIKRYVD 359

Query: 839  KPLASAWMVTMALQNYP---TLELMSEMLRMAQYSPSQITIFPLSIMVHNYWMNNEEIHT 895
            +     W++  A    P   T+ ++S +L + Q S +Q  I   S  ++ +  +N+ +  
Sbjct: 360  QTTIDNWIIAFAFIPQPDRNTINILSPLLELRQLSETQF-ILSYSATIYAF-CSNQGVQR 417

Query: 896  AATLPEPIVKTIRYLKSLIGNDC---TVSAENERLALVALKAIGNIGEPVERYDQLTFIF 952
               + E + + + +L+  I   C   T S    +  L ALKAIGN+G           + 
Sbjct: 418  CINV-EQVTRFLSHLEQKIEKGCAPRTHSFSAIKETLEALKAIGNMG-----------LE 465

Query: 953  SERVSPVLISCTKNKQ--IPRDISKAAIQSMRRFVMSDQLRSQVISELFKDTTLDVPQRI 1010
            +ER+  +L  CT +    +P +I  A+I + RR    ++ R       +++ +LD   RI
Sbjct: 466  TERLLKLLKECTDDVGGFLPMEIRVASIDAHRRMPSCEKTRDLYFLNYYRNFSLDTELRI 525

Query: 1011 AAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIKNVVESSEPTLQEFKMNLKIA 1070
            A+YL  M+  P  + +  I + LK E +NQ+  F +SH+ N+  S+ PT    K+ ++  
Sbjct: 526  ASYLQVMRC-PDYNVVKTIKHTLKLEEINQVGTFVWSHLTNIYNSASPT----KVEIQSL 580

Query: 1071 MDGEELPE-YPKDIRKYSRFFELSKNLTEPWRNNTVAAQFESDIIFNPESYLPQEVMFHY 1129
            +   +L E +  D RK+SR ++ S    E        A ++ ++IF+P+SY+P+ V F+ 
Sbjct: 581  LTDRDLDEKFNNDRRKFSRNYDGSFFSEE----YNFGANYQGNLIFSPKSYIPRSVTFNL 636

Query: 1130 VLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQTMFDTIDEKILSKVREFAE 1189
              +  G+S+++ E    ++G E   E  FGP+G +   K+ + F       L   R F  
Sbjct: 637  TFDLFGESVNVVEVTTRLEGLEYYAEKFFGPDGPYSNEKVSSFF-------LQLFRSFRA 689

Query: 1190 AQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQSSFGEPQVVDVIHENTMNKLNQLHYLVGM 1249
            A           P+ E     D Y K++KR      P V+D       N  N        
Sbjct: 690  A-----------PEQE-----DDYWKRVKRI-----PNVID-------NNFN-------- 713

Query: 1250 EPSATDATVFLRLFGNEFGFVSASDVLALIPYTMGIYEEL--LNKTKQIPQLLSQGLNLN 1307
            EP  +   +  ++FGN+  + + +           I + L  LN  ++  Q++S G  ++
Sbjct: 714  EPRIS---LTYKVFGNDLKYSTLNG-------DREIRDALTHLNPWEKFKQIIS-GKEIH 762

Query: 1308 TTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLRMKSQF---SFNLPKIIAAGHVAPSG 1364
                 +F+D +++VP   G+P+   + G+A  + +M       + +  +I    +VAPS 
Sbjct: 763  --HEIMFLDFTYVVPMTTGLPVRLDLAGSAACNFKMSGLLDTRAISKAEIEFISNVAPSI 820

Query: 1365 AVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGNITIDGTH-LKINLNNTDRPMNLFNY 1423
             V+   +M +    K   G      +Y S  +  ++ + G   +K++L   ++   +F+ 
Sbjct: 821  NVDTTGSMTVDAFYKT-AGTKLRTNLYSSGAVQIHLEVKGVRSMKLSLGLPNKRTEMFSI 879

Query: 1424 STTYNLLKANG------------------DIEFIPGVLQDAVQSQRCT--NVSKVFGVDL 1463
            +T   L + NG                  D      + ++ + +  CT   + ++ G+ L
Sbjct: 880  ATDILLTRGNGAEHEEKPLGVLIAGQQSNDRSLTRSLPKNVIANTSCTWAALDRLVGLKL 939

Query: 1464 CVSWAYPNASYVAEAPRFPFSGPNSFNVTLVNTDQALKAY 1503
            C+ +   N +    A  F  +GP  F + L+  D   K Y
Sbjct: 940  CLDYQLSNVTKNPNASYFILNGPALFKIALIKADPTAKNY 979
>ref|XP_001356369.1| GA13976-PA [Drosophila pseudoobscura]
          Length = 4334

 Score =  188 bits (478), Expect = 2e-045
 Identities = 232/1019 (22%), Positives = 429/1019 (42%), Gaps = 104/1019 (10%)

Query: 534  EMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGILSMIQLDLEADDVDQITLNEVSVH 593
            ++S + L F   +G I EV     E   +LN K+GILS  Q  +   DVD  T  E  V 
Sbjct: 153  DLSKNLLRFAFHDGLIGEVCPQEQETPWVLNIKKGILSAFQNTMMRFDVDFNT-TETDVS 211

Query: 594  GNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENM--TRWQSFKDMVLNMTVMDKF 651
            G C  +  +   D+      ++   ++ +C  R    ++  T   +F+D   + T+    
Sbjct: 212  GECQVQYALEATDNVYVT--IRKTKDIASCRQRYATHSVLQTTPYTFRD---DKTIWP-I 265

Query: 652  INSSKTCSYDLKGTTGEFRGIQCEEVHSFWPMNFNSESGVRTFIQQRLISTAIDRLNSYK 711
            +NS   C+  +      +R I C E H   P + N+ SG  T  + RL+    +  ++ +
Sbjct: 266  LNSQSYCNLTVDQRM--YREISCVETHLLVPFS-NASSGALTTSRSRLLLKEEENYSAGE 322

Query: 712  VDPAN----SRSTCLRYEHDPKEIGKKADDVTADQAMDILKALVKSSREEVQMESPRLFG 767
                N     R   L ++H P  +    D++ A  A + L  +       +Q E   +F 
Sbjct: 323  FLEQNPELVDRRATLVFDHTPA-VKPSHDEIKA--AREQLVEMCALGFPNIQREFIDIFS 379

Query: 768  RWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIAREYLLDGLLPCTTMACFSV 827
             +    + ++ +T+  +  R+      + TC          R ++L+ L    + A + V
Sbjct: 380  SFLHTCKSLDYKTLSVLLQRS------AGTCDQG-------RNHVLESLPYIGSTASYQV 426

Query: 828  KNYAIAKGVVPKPLASAWMVTMALQNYP---TLELMSEMLRMAQYSPSQITIFPLSIMVH 884
                I    +PK +A +WM +++    P   TLE    +L  A++          + +VH
Sbjct: 427  MRDQIVGEKLPKQMAHSWMTSLSFITRPDEQTLETFYTILEYAKHRLDPEYTLGATAVVH 486

Query: 885  NYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSAENERLALVALKAIGNIGEPVER 944
            +Y  ++E    +  + + I        S            ERL +V LK +GNIG     
Sbjct: 487  SYCKHHEACEESLRVQQIINLLETEFLSRFQVYKGERKHRERL-VVLLKGLGNIGV---- 541

Query: 945  YDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQLRSQ-VISELFKDTT 1003
               ++  F+E+V  ++    ++  +P D+    I + RR    D L+ +    + + + T
Sbjct: 542  ---ISAAFAEQVQEII----RDDAVPVDLRLQGILAFRRV---DCLKYRGYFLDRYANYT 591

Query: 1004 LDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIKNVVESSEPTLQEF 1063
            L+   RI +YL  M+  P    +  I   L  E +NQ+ +F +SH+ N+ +S+ P   E 
Sbjct: 592  LNAELRIYSYLQAMRC-PDYISVGSIKAILDHEQINQVGSFVWSHLTNLAKSNSPVRIEA 650

Query: 1064 KMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFESDIIFNPESYLPQ 1123
            +    + ++ E    +  DIRK+SR +E S    E     T     ++++IF  +SYLP+
Sbjct: 651  Q---GLLLNDELSERFKLDIRKFSRNYEHSLFFDEYNFGTTT----DANLIFGTDSYLPR 703

Query: 1124 EVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQTMF---------- 1173
                ++  +  G+S++ FE     +G E ++   FGP+G F    L+             
Sbjct: 704  IASVNFTADLFGQSVNFFEFSARAEGLEELVAGAFGPKGPFNGELLRKKLSFLNRWLGNE 763

Query: 1174 -----DTIDEKI------LSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQSS 1222
                 DTI+  +      L +  + A A  G     T E D +   ++   G K +++ +
Sbjct: 764  SAEEEDTIENLLSLDSLRLKRKAQLAAAAAGG--AGTEEEDEDYDYEEALSGSKRQKRDA 821

Query: 1223 FGEPQVVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLALIPYT 1282
             G         ++    +++L Y +  + S   A   LR+FGN+  + +   ++ ++   
Sbjct: 822  -GAAASASARKDSIDRNVDKLGYKLKYDYSNPRAQFGLRVFGNDLRYYNVESMMEVMALA 880

Query: 1283 MGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLR 1342
                    N  +Q  ++LS G     T+S VF+D S+ VP  +G+PL     G + V LR
Sbjct: 881  -----AQFNPFEQANRVLS-GKEFTYTKSRVFLDASYTVPLAVGLPLAIHAFGASSVDLR 934

Query: 1343 MKSQFSFNLP----KIIAAGHVAPSGAVEVLATMGIGMPTKVF---TGVMANATVYHSSM 1395
            +        P         G   PS +V++++T    M T +F   +G+   + +Y +S 
Sbjct: 935  VSGSLDQMEPPTDWHFDVQGRFKPSVSVDIIST----MQTDMFWGESGIKVKSNLYSNSE 990

Query: 1396 LAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCT-- 1453
            L  ++ + G +L     N  +  N   +S    LL    D E     +     +  CT  
Sbjct: 991  LEASLKVRGRNLVSFSFNLPQDKNEI-FSVRSELLVMKRDQELPQAGIPKRSSNSTCTWP 1049

Query: 1454 NVSKVFGVDLCVSWAYPNASYVAEA-PRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQ 1511
             +    G+ +C  ++  + S    A P    +GP + ++ L  +D + K Y  + ++ Q
Sbjct: 1050 VLDSALGLQMCSHYSVADLSNATSAYPSLLLAGPLNLSLILKKSDLSSKKYVFEYRWDQ 1108
>ref|NP_995670.1| CG15828-PB, isoform B [Drosophila melanogaster]
          Length = 4374

 Score =  186 bits (472), Expect = 9e-045
 Identities = 232/1024 (22%), Positives = 430/1024 (41%), Gaps = 103/1024 (10%)

Query: 527  ENRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGILSMIQLDLEADDVDQIT 586
            ++ D + +++ + L F   +G I EV     E   +LN K+GILS  Q  +   DVD  T
Sbjct: 183  KSSDFNVDLTKNLLRFAFHDGLISEVCPQEQETPWVLNIKKGILSAFQNTMMRFDVDANT 242

Query: 587  LNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENM--TRWQSFKDMVLN 644
              E  V G C  +  +   D       ++   ++N+C  R    ++  T   +F+D   +
Sbjct: 243  -TETDVSGQCQVQYALEDTDSSYVT--IRKTKDINSCRQRYATHSVLQTTPYTFRD---D 296

Query: 645  MTVMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSFWPMNFNSESGVRTFIQQRLISTAI 704
             T+    + S   C+  +      ++ I+C E H   P + N+ SG  T    RL    +
Sbjct: 297  KTIWP-ILKSQSHCNLTIDNNV--YKEIKCLETHLLVPFS-NASSGALTTSTSRLKLDGV 352

Query: 705  DRLNSYKVDPAN----SRSTCLRYEHDPKEIGKKADDVTADQAMDILKALVKSSREEVQM 760
            +  ++ +    N     R   L ++H P  +    D++ A  A ++L  + +     +Q 
Sbjct: 353  ESYSAGEFLEQNPELVERRATLVFDHTPA-VKPSHDEIKA--ARELLVEMCRVGFPNIQR 409

Query: 761  ESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIAREYLLDGLLPCT 820
            E   +F  +    + ++ +T+  +  R+      + TC          R +LL+ L    
Sbjct: 410  EFIDVFTNFLQTSKSLDYKTLSVLLQRS------ASTCEQG-------RNHLLESLPFIG 456

Query: 821  TMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQYSPSQITI---F 877
            + A + V    I    + K +A  WM  ++    P  E +     + +Y+ +++      
Sbjct: 457  STASYKVMRDQIINEKLTKQMAHDWMTALSFITRPDEETLETFHSILEYAKNRLDAEYTL 516

Query: 878  PLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSAENERLALVALKAIGN 937
              + +VH++  ++E       + + I        +L           ER+ ++ LK +GN
Sbjct: 517  GATAVVHSFCKHHEACEENLRVQQIINLLETEFLNLYNLFKGERRTRERMVIL-LKGLGN 575

Query: 938  IGEPVERY-DQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQLRSQVIS 996
            IG     + +QL +I  E  +PV            DI    I + RR V   + RS  + 
Sbjct: 576  IGVVSSAFAEQLQWIIREDEAPV------------DIRLHGILAFRR-VDCARHRSYFLD 622

Query: 997  ELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIKNVVESS 1056
              + + TL+   RI +YL  M+  P    +  I + L+ E +NQ+ +F +SH+ N+ +S+
Sbjct: 623  N-YGNYTLNSELRIYSYLQAMRC-PDYISVGVIKSILEHEEINQVGSFVWSHLTNLAKSN 680

Query: 1057 EPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFESDIIFN 1116
             P   E +    + ++ E    +  DIRK+SR +E S    E     T     ++++IF 
Sbjct: 681  SPVRIEAQ---GLLLNDELSERFKMDIRKFSRNYEHSLFFDEYNFGTTT----DANVIFG 733

Query: 1117 PESYLPQEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQTMF--- 1173
             +SYLP+    ++  +  G+S++ FE     +G E +  + FGP+G      L+      
Sbjct: 734  TDSYLPRIASVNFTADLFGQSVNFFEFTARAEGLEELAANAFGPKGPLSGQLLRKKLSFL 793

Query: 1174 ------------DTIDEKI-LSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQ 1220
                        DT++  + L  +R   +AQ     +     ++  F +  +  K+ KR 
Sbjct: 794  NRWLGNESAEEDDTLENLLSLDNLRLKRKAQEQARASEEEVDEDYDFEESLEGNKRQKRD 853

Query: 1221 SSFGEPQVVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNE---FGFVSASDVLA 1277
             S    Q +D         ++ L Y +  + +   A   LR+FGN+   F   S  +V+A
Sbjct: 854  VSTTRKQEID-------RNVDSLGYKLKYDYNNPRAQFGLRVFGNDLRYFNVESLVEVMA 906

Query: 1278 LIPYTMGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTA 1337
            L            N  +Q   +LS G     T+S VF+D S+ VP  +G+PL     G +
Sbjct: 907  L--------AAKFNPFQQAKNVLS-GKEFTYTKSRVFLDASYTVPLAVGLPLAIHAFGAS 957

Query: 1338 VVSLRMKSQFSFNLP----KIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHS 1393
             + LR+        P         G   PS +V+V+ TM   M  +  +G+   + +Y +
Sbjct: 958  SIDLRVSGNLDEMDPPTDWHFDVEGQFKPSVSVDVITTMQTDMFWEQ-SGIKVKSNLYSN 1016

Query: 1394 SMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCT 1453
            S L   + + G +L     +  R  N   +S    LL    + +     + +   +  CT
Sbjct: 1017 SELVAKLKVRGRNLVSFSFDLPRDKNEI-FSVRSELLVQKREEQLPQAGIANRSANSTCT 1075

Query: 1454 --NVSKVFGVDLCVSWAYPNASYVAEA-PRFPFSGPNSFNVTLVNTDQALKAYTIDAQYK 1510
               + +  G+ +C  ++ P+ S   E  P    +GP +F++ L  +D + K Y  + ++ 
Sbjct: 1076 WPVLDQAIGLQMCSHYSVPDLSNATEIYPSLLLAGPLNFSLILKKSDLSAKKYVFEYKWD 1135

Query: 1511 QIRE 1514
            Q  E
Sbjct: 1136 QQEE 1139
>ref|XP_606415.3| PREDICTED: hypothetical protein [Bos taurus]
          Length = 2528

 Score =  168 bits (426), Expect = 2e-039
 Identities = 233/1083 (21%), Positives = 435/1083 (40%), Gaps = 187/1083 (17%)

Query: 477  GYSYTFKYEAETESGIKGAGPG-SNMTMTCDIIIEAPERCRNVLKAR---RCLL------ 526
            G  Y + +   T + ++GA  G S + +   + ++    C+  L+ R   +C+L      
Sbjct: 27   GTRYVYHFSTNTSTSLQGAQVGGSGLGLQGLVTLDVLGPCQMALQERSPTQCILLQLQHF 86

Query: 527  --------------ENRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGILSM 572
                          ++  L   +    L    Q GR++ +     EP   LN KR +LS+
Sbjct: 87   QLTSILGSKVEVLKQSESLSAVLGREPLRLVLQAGRVVRLCPRRAEPRWALNVKRAVLSL 146

Query: 573  IQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENM 632
            +Q      D    T+ EV + G C +         +Q   +L     L  C LR+     
Sbjct: 147  LQSHPGVRDPH--TVEEVDILGRCPTTY-------QQLGSRLHKTKALGQCSLRRVRA-- 195

Query: 633  TRWQSFKDMVLNMTVMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSFWPMNFNSESG-V 691
                S +   L        + S  TC   L+   G  R   C ++ +  P++  + +  +
Sbjct: 196  ----SLRSQALPAAEEQSGLASRLTCVQSLQA--GVLREASCTQLDTAGPLSREASTAPM 249

Query: 692  RTF-----IQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDVTADQAMDI 746
             TF     +Q+  +  A+    +   D  +   + L YE +       +    A  A  +
Sbjct: 250  STFSSLSLLQEVPLDPAVTERLTSDSDSGDLTPSSLLYEWEETP----SQATVAAGAASV 305

Query: 747  LKALVKSSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEK 806
             +  +  +      E+  LF    + L G++ + + E++  ++ C       RDN     
Sbjct: 306  RRLCLAQA---TSFEATELFLTLVSELRGLSADELMELWGLSFKC-------RDN----- 350

Query: 807  IAREYLLDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRM 866
               + L+D L  C T AC  +    I  G V      AW+ ++A    PT   +  +L  
Sbjct: 351  --WQPLVDALPSCGTEACVGLMAELIMSGEVEADETEAWLWSLAFVPEPTDATVRVLLAP 408

Query: 867  AQYSPSQITIFPLSIMVHNYWMNN----EEIHTAATLPEPIVKTIRYLKSLIGNDCTVSA 922
               S + + I   S +VHN  ++     E++    +L       +R L   +G +CT   
Sbjct: 409  GASSSAFLGI---SALVHNLCVSLDGPCEQLSGVGSL-------VRILGDAVGANCTFWE 458

Query: 923  ENERLALV-ALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSM 981
             ++   L+  LKAIGN G             +  ++P L +C      P +I   AIQ+ 
Sbjct: 459  PSDADQLLFVLKAIGNAGRA-----------ATALTPKLSTCASLGSCPPEIRLGAIQAF 507

Query: 982  RRFVMSDQLRSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQM 1041
            RR   S      V+S L+++   D   RI AYL  M+  P       +      E   Q 
Sbjct: 508  RRVPCSAD--RSVLSSLYQNAEEDPEIRINAYLALMRC-PGEEVFAQVRRTQAREQSTQG 564

Query: 1042 KAFCYSHIKNVVESSEPTLQEFKMNLKIAMDGEELP-EYPKDIRKYSRFFELSKNLTEPW 1100
            +         ++E+ +P     K +L+ A+  + L  E+  ++ K+S +     ++T   
Sbjct: 565  EQL------QLLETDDP----LKQSLREAVPQDILSREFHPEVWKHSSY----SDVTFRS 610

Query: 1101 RNNTVAAQFESDIIFNPESYLPQEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGP 1160
             + ++ A  E  ++F+P S+LP+    +  ++ALG + ++ E G+ ++  E +   +FGP
Sbjct: 611  ASGSLGANLEGTLLFSPASFLPRSATANLTIHALGHAFNLLELGLRLENAEEMARRLFGP 670

Query: 1161 EGFFPEVKLQTMFDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQ 1220
            + F+ +          +E+  ++ +E  EA+ G    PT +P +         G++ ++ 
Sbjct: 671  KSFWGQ----------EEERQAQAKEPPEAEPG----PTLQPADPACT-----GERSRK- 710

Query: 1221 SSFGEPQVVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASDVLALIP 1280
                            M  L Q       E  A    + +++FG+E  FV+   + + + 
Sbjct: 711  ----------------MRDLQQKVARRRGERQALKCQLSMKVFGHELSFVNCGAMGSHVT 754

Query: 1281 YTMGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVS 1340
            +      EL      I  L  Q + +N   + V  + +F  PT  G+P   ++N +A VS
Sbjct: 755  HQSLNLAEL-----AIKLLKGQEVQVNRRLNLVMEELTF--PTMSGLPARLTLNVSAAVS 807

Query: 1341 LRMKSQFSFNLPKIIAA-GHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGN 1399
            +R++    F      +  G+V PS  +++ A MG         G +  A +   + + G 
Sbjct: 808  IRVRGTADFQQRSDFSVKGYVKPSALLQISAQMGT-------VGALGQAGLRWVTGVRGT 860

Query: 1400 ITID-------GTHLKINLNNTDRPMNLFNYSTTYNLLKANG--DIEFIPGVLQDAVQSQ 1450
             ++D       G  L+++LN  +  + LF +S+   L+  +G   +  +P       ++Q
Sbjct: 861  ASLDGGIQARKGQDLRVHLNTPEEVVELFRFSSQLYLITGDGVRSLNHVP----SPSEAQ 916

Query: 1451 RCTN--VSKVFGVDLC--VSWAYPNASYVAEAPRFPFSGPNSFNVTLVNTDQALKAYTID 1506
             CT+   +  +G  LC  V W  P+   +   P F         +TL   DQ L+ Y ++
Sbjct: 917  SCTSKEAAHTWGWQLCTEVRWPAPDQPSLLSVPVFT-------AMTLKKQDQGLQQYLLE 969

Query: 1507 AQY 1509
            A Y
Sbjct: 970  AAY 972
>ref|NP_609304.1| CG15828-PA, isoform A [Drosophila melanogaster]
          Length = 4345

 Score =  168 bits (426), Expect = 2e-039
 Identities = 229/1021 (22%), Positives = 418/1021 (40%), Gaps = 126/1021 (12%)

Query: 527  ENRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGILSMIQLDLEADDVDQIT 586
            ++ D + +++ + L F   +G I EV     E   +LN K+GILS  Q  +   DVD  T
Sbjct: 183  KSSDFNVDLTKNLLRFAFHDGLISEVCPQEQETPWVLNIKKGILSAFQNTMMRFDVDANT 242

Query: 587  LNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENM--TRWQSFKDMVLN 644
              E  V G C  +  +   D       ++   ++N+C  R    ++  T   +F+D   +
Sbjct: 243  -TETDVSGQCQVQYALEDTDSSYVT--IRKTKDINSCRQRYATHSVLQTTPYTFRD---D 296

Query: 645  MTVMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHSFWPMNFNSESGVRTFIQQRLISTAI 704
             T+    + S   C+  +      ++ I+C E H   P + N+ SG  T    RL    +
Sbjct: 297  KTIWP-ILKSQSHCNLTIDNNV--YKEIKCLETHLLVPFS-NASSGALTTSTSRLKLDGV 352

Query: 705  DRLNSYKVDPAN----SRSTCLRYEHDPKEIGKKADDVTADQAMDILKALVKSSREEVQM 760
            +  ++ +    N     R   L ++H P  +    D++ A  A ++L  + +     +Q 
Sbjct: 353  ESYSAGEFLEQNPELVERRATLVFDHTPA-VKPSHDEIKA--ARELLVEMCRVGFPNIQR 409

Query: 761  ESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIAREYLLDGLLPCT 820
            E   +F  +    + ++ +T+  +  R+      + TC          R +LL+ L    
Sbjct: 410  EFIDVFTNFLQTSKSLDYKTLSVLLQRS------ASTCEQG-------RNHLLESLPFIG 456

Query: 821  TMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQYSPSQITIFPLS 880
            + A + V                            TLE    +L  A+           +
Sbjct: 457  STASYKVMQ--------------------------TLETFHSILEYAKNRLDAEYTLGAT 490

Query: 881  IMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSAENERLALVALKAIGNIGE 940
             +VH++  ++E       + + I        +L           ER+ ++ LK +GNIG 
Sbjct: 491  AVVHSFCKHHEACEENLRVQQIINLLETEFLNLYNLFKGERRTRERMVIL-LKGLGNIGV 549

Query: 941  PVERY-DQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQLRSQVISELF 999
                + +QL +I  E  +PV            DI    I + RR V   + RS  +   +
Sbjct: 550  VSSAFAEQLQWIIREDEAPV------------DIRLHGILAFRR-VDCARHRSYFLDN-Y 595

Query: 1000 KDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIKNVVESSEPT 1059
             + TL+   RI +YL  M+  P    +  I + L+ E +NQ+ +F +SH+ N+ +S+ P 
Sbjct: 596  GNYTLNSELRIYSYLQAMRC-PDYISVGVIKSILEHEEINQVGSFVWSHLTNLAKSNSPV 654

Query: 1060 LQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFESDIIFNPES 1119
              E +    + ++ E    +  DIRK+SR +E S    E     T     ++++IF  +S
Sbjct: 655  RIEAQ---GLLLNDELSERFKMDIRKFSRNYEHSLFFDEYNFGTTT----DANVIFGTDS 707

Query: 1120 YLPQEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQTMF------ 1173
            YLP+    ++  +  G+S++ FE     +G E +  + FGP+G      L+         
Sbjct: 708  YLPRIASVNFTADLFGQSVNFFEFTARAEGLEELAANAFGPKGPLSGQLLRKKLSFLNRW 767

Query: 1174 ---------DTIDEKI-LSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQSSF 1223
                     DT++  + L  +R   +AQ     +     ++  F +  +  K+ KR  S 
Sbjct: 768  LGNESAEEDDTLENLLSLDNLRLKRKAQEQARASEEEVDEDYDFEESLEGNKRQKRDVST 827

Query: 1224 GEPQVVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNE---FGFVSASDVLALIP 1280
               Q +D         ++ L Y +  + +   A   LR+FGN+   F   S  +V+AL  
Sbjct: 828  TRKQEID-------RNVDSLGYKLKYDYNNPRAQFGLRVFGNDLRYFNVESLVEVMAL-- 878

Query: 1281 YTMGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVS 1340
                      N  +Q   +LS G     T+S VF+D S+ VP  +G+PL     G + + 
Sbjct: 879  ------AAKFNPFQQAKNVLS-GKEFTYTKSRVFLDASYTVPLAVGLPLAIHAFGASSID 931

Query: 1341 LRMKSQFSFNLP----KIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSML 1396
            LR+        P         G   PS +V+V+ TM   M  +  +G+   + +Y +S L
Sbjct: 932  LRVSGNLDEMDPPTDWHFDVEGQFKPSVSVDVITTMQTDMFWEQ-SGIKVKSNLYSNSEL 990

Query: 1397 AGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCT--N 1454
               + + G +L     +  R  N   +S    LL    + +     + +   +  CT   
Sbjct: 991  VAKLKVRGRNLVSFSFDLPRDKNEI-FSVRSELLVQKREEQLPQAGIANRSANSTCTWPV 1049

Query: 1455 VSKVFGVDLCVSWAYPNASYVAEA-PRFPFSGPNSFNVTLVNTDQALKAYTIDAQYKQIR 1513
            + +  G+ +C  ++ P+ S   E  P    +GP +F++ L  +D + K Y  + ++ Q  
Sbjct: 1050 LDQAIGLQMCSHYSVPDLSNATEIYPSLLLAGPLNFSLILKKSDLSAKKYVFEYKWDQQE 1109

Query: 1514 E 1514
            E
Sbjct: 1110 E 1110
>ref|XP_001178596.1| PREDICTED: similar to apolipophorin precursor protein
            [Strongylocentrotus purpuratus]
          Length = 3592

 Score =  151 bits (382), Expect = 2e-034
 Identities = 243/1098 (22%), Positives = 423/1098 (38%), Gaps = 171/1098 (15%)

Query: 463  VPELECSELTR-------FKEGYSYTFKYEAETESGIKGAGPGSNMTMTCDI----IIEA 511
            V E +C+E          F+   SY F Y+ E +S I  +GP S+ + T  I    +IE 
Sbjct: 21   VRETQCAEECNSRDDEGMFRAFKSYYFSYDVEIDSRI--SGPTSDQSSTVRIGAVAVIEG 78

Query: 512  PERCRNVLKARRCLLENRDLDEEM-------------SAHDLVFRTQ-NGRIIEVLAHPD 557
               C  VLK     ++ +  D  M              AH L F  + NG I  V     
Sbjct: 79   LSACDMVLKLSDISIQEKRQDGIMVAAETASTFSLALEAHPLRFSMEGNGTITSVCPEAG 138

Query: 558  EPLHILNAKRGILSMIQLDLEADD--VDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQ 615
            E +  LN KRG LS +Q      +  +++    E  V G C    + T            
Sbjct: 139  EEIWALNVKRGFLSHMQTKRTTSNNVLEEGGAFETGVTGTCMPVYSPTGE---------M 189

Query: 616  VVTELNNCMLRKQEENMTRWQSFKDMVLNMTVMDKFINSSKTCSYDLKGTTGEFRGIQCE 675
               + N+ ++ K   N+  +     + L        + S   C Y +   +     ++C 
Sbjct: 190  TFLKSNDFLMCKHRTNLNMFVDAIPVHLLAPTASP-LTSRMECEYQMDSQS--ISSVECH 246

Query: 676  EVHSFWPMNFNSESGVRTFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKA 735
            E H+  P    S+S     +   +  T +    S  +    +R T L YE DP ++    
Sbjct: 247  ETHALRPFAA-SDSQPEIMVHTSITKTDVRSTISSSLSSEFARRTSLLYE-DPIQVS--- 301

Query: 736  DDVTADQAMDILKALVKSSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYS 795
             ++ +D   + +  +  S    +  E+P LF         ++   ++ V +R +      
Sbjct: 302  -EINSDDVRNTITQICNSITNGISSETPGLFETLTKQFGELDTNNMNTVINRLF------ 354

Query: 796  QTCRDNPDKEKIAREYLLDGLLPCTTMACFSVKNYAIAK--GVVPKPLASAWMVTMALQN 853
            + C +    E I  + + D L  C T  C    +  IA    V  +     W + +    
Sbjct: 355  RICPEVETNEVI--KMVKDALTDCDTEQCAQGFHSIIASENSVENEFYLRKWFMKLVFHK 412

Query: 854  YPTLELMSEMLRMA--QYSPSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLK 911
             PT  +++ + R        +    + LS M+H Y   +E+    +   + +   I +  
Sbjct: 413  NPTKNMINLVKRYVGGNQEMNLPAYYALSSMIHQYCRMSED--DCSRDADILSAAIVFED 470

Query: 912  SLIGNDCTVSAENERLALVALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPR 971
            +L  +    S E+E+  L++++AIGN+G           I S+ +   L  C ++ Q P 
Sbjct: 471  NLHDSCLPESEEDEKKILMSVRAIGNMG----------LIQSKSL---LNKCNRD-QNPG 516

Query: 972  DISKAAIQSMRRFVMSDQLRSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWN 1031
             +  AAIQ+ RR   +D    + +  +F     D   RIAAY   ++  PS + L  I N
Sbjct: 517  LLRVAAIQAYRRASCNDVPTDRYM-RIFSTIDNDSELRIAAYRAIIRC-PSETLLQGIAN 574

Query: 1032 FLKTEPVNQMKAFCYSHIKNVVESSEPTLQEFKMNLKIAMDGEELPEYPK---DIRKYSR 1088
             +  EP NQ+  +  SH+ N+  S +P +    ++L+ A+    L    K   D RK+S 
Sbjct: 575  TMAVEPTNQVTCYVSSHLANLRNSQDPMV----VDLQTAISQSPLANVTKCGMDYRKFSH 630

Query: 1089 FFELSKNLTEPWRNNTVAAQFESDIIFNPESYLPQEVMFHYVLNALGKSMDIFETGIEMK 1148
             + LS    E          F+SD++F+ +SYLP+       ++  G   D+FE      
Sbjct: 631  NYGLSYFDDESGNG----IHFDSDVVFSSQSYLPRSARLAMNVDLFGYGFDLFELDARTV 686

Query: 1149 GFEPIIESVFGPEGFFPEVKLQTMFDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEV-F 1207
            GF+  +E            +L T+                           SE D E   
Sbjct: 687  GFQDALE------------ELMTL---------------------------SEEDREANM 707

Query: 1208 IKK--DKYGKKMKRQSSFGEPQVVDVIHENTMNKL-NQLHYLVGMEPSATDATVFLRLFG 1264
            I+K      K++ RQ   G       I  + +N++ NQ      +E  A  A V +++ G
Sbjct: 708  IEKVHRMMNKRVNRQRREG-------IKTSALNRIKNQYETSHDVEEEAEGAFVAMKVLG 760

Query: 1265 NEFGFVSASDVLALIPYTMGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTG 1324
            N+  +    D+  +        E L+     +    S   +LN      F      +PT 
Sbjct: 761  NDVFYKDRDDIERMAERFS--RERLMEIIASLVSQRSHEYSLNKN----FKTSKVTIPTI 814

Query: 1325 MGMPLNCSINGTAVVSLRMKSQFS----FNLPKIIAA-GHVAPSGAVEVLATMGIGMPTK 1379
             GMPL  +I G     L+   +         P+ +A  G   PS A+E+ + M +     
Sbjct: 815  AGMPLEVNIQGAFNTILKASGKLDVLGMMATPRRMAVQGLFEPSAAIEINSNMMVDAHC- 873

Query: 1380 VFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLKANGDIEFI 1439
              +G+     +  S  L G+++ +   LK  +    R   + + S++   ++ N   E +
Sbjct: 874  ARSGLSHKTNMASSLSLGGSLSFENGMLKAKVTAPPRRETIIDASSSLFFMQRN---EMV 930

Query: 1440 P-GVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSF------NVT 1492
            P    +DAV     T++ + F  D        N       P   FS P +F       +T
Sbjct: 931  PVSEPEDAV-----TSIEETFANDRY------NLHISGTRPNMAFSLPQAFFQNWRMEIT 979

Query: 1493 LVNTDQALKAYTIDAQYK 1510
            L   + +L +Y ++A ++
Sbjct: 980  LDKLEDSLVSYDLEAGFR 997
>ref|XP_795269.2| PREDICTED: similar to apolipophorin precursor protein, partial
            [Strongylocentrotus purpuratus]
          Length = 3573

 Score =  151 bits (382), Expect = 2e-034
 Identities = 243/1098 (22%), Positives = 423/1098 (38%), Gaps = 171/1098 (15%)

Query: 463  VPELECSELTR-------FKEGYSYTFKYEAETESGIKGAGPGSNMTMTCDI----IIEA 511
            V E +C+E          F+   SY F Y+ E +S I  +GP S+ + T  I    +IE 
Sbjct: 2    VRETQCAEECNSRDDEGMFRAFKSYYFSYDVEIDSRI--SGPTSDQSSTVRIGAVAVIEG 59

Query: 512  PERCRNVLKARRCLLENRDLDEEM-------------SAHDLVFRTQ-NGRIIEVLAHPD 557
               C  VLK     ++ +  D  M              AH L F  + NG I  V     
Sbjct: 60   LSACDMVLKLSDISIQEKRQDGIMVAAETASTFSLALEAHPLRFSMEGNGTITSVCPEAG 119

Query: 558  EPLHILNAKRGILSMIQLDLEADD--VDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQ 615
            E +  LN KRG LS +Q      +  +++    E  V G C    + T            
Sbjct: 120  EEIWALNVKRGFLSHMQTKRTTSNNVLEEGGAFETGVTGTCMPVYSPTGE---------M 170

Query: 616  VVTELNNCMLRKQEENMTRWQSFKDMVLNMTVMDKFINSSKTCSYDLKGTTGEFRGIQCE 675
               + N+ ++ K   N+  +     + L        + S   C Y +   +     ++C 
Sbjct: 171  TFLKSNDFLMCKHRTNLNMFVDAIPVHLLAPTASP-LTSRMECEYQMDSQS--ISSVECH 227

Query: 676  EVHSFWPMNFNSESGVRTFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKA 735
            E H+  P    S+S     +   +  T +    S  +    +R T L YE DP ++    
Sbjct: 228  ETHALRPFAA-SDSQPEIMVHTSITKTDVRSTISSSLSSEFARRTSLLYE-DPIQVS--- 282

Query: 736  DDVTADQAMDILKALVKSSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYS 795
             ++ +D   + +  +  S    +  E+P LF         ++   ++ V +R +      
Sbjct: 283  -EINSDDVRNTITQICNSITNGISSETPGLFETLTKQFGELDTNNMNTVINRLF------ 335

Query: 796  QTCRDNPDKEKIAREYLLDGLLPCTTMACFSVKNYAIAK--GVVPKPLASAWMVTMALQN 853
            + C +    E I  + + D L  C T  C    +  IA    V  +     W + +    
Sbjct: 336  RICPEVETNEVI--KMVKDALTDCDTEQCAQGFHSIIASENSVENEFYLRKWFMKLVFHK 393

Query: 854  YPTLELMSEMLRMA--QYSPSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLK 911
             PT  +++ + R        +    + LS M+H Y   +E+    +   + +   I +  
Sbjct: 394  NPTKNMINLVKRYVGGNQEMNLPAYYALSSMIHQYCRMSED--DCSRDADILSAAIVFED 451

Query: 912  SLIGNDCTVSAENERLALVALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPR 971
            +L  +    S E+E+  L++++AIGN+G           I S+ +   L  C ++ Q P 
Sbjct: 452  NLHDSCLPESEEDEKKILMSVRAIGNMG----------LIQSKSL---LNKCNRD-QNPG 497

Query: 972  DISKAAIQSMRRFVMSDQLRSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWN 1031
             +  AAIQ+ RR   +D    + +  +F     D   RIAAY   ++  PS + L  I N
Sbjct: 498  LLRVAAIQAYRRASCNDVPTDRYM-RIFSTIDNDSELRIAAYRAIIRC-PSETLLQGIAN 555

Query: 1032 FLKTEPVNQMKAFCYSHIKNVVESSEPTLQEFKMNLKIAMDGEELPEYPK---DIRKYSR 1088
             +  EP NQ+  +  SH+ N+  S +P +    ++L+ A+    L    K   D RK+S 
Sbjct: 556  TMAVEPTNQVTCYVSSHLANLRNSQDPMV----VDLQTAISQSPLANVTKCGMDYRKFSH 611

Query: 1089 FFELSKNLTEPWRNNTVAAQFESDIIFNPESYLPQEVMFHYVLNALGKSMDIFETGIEMK 1148
             + LS    E          F+SD++F+ +SYLP+       ++  G   D+FE      
Sbjct: 612  NYGLSYFDDESGNG----IHFDSDVVFSSQSYLPRSARLAMNVDLFGYGFDLFELDARTV 667

Query: 1149 GFEPIIESVFGPEGFFPEVKLQTMFDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEV-F 1207
            GF+  +E            +L T+                           SE D E   
Sbjct: 668  GFQDALE------------ELMTL---------------------------SEEDREANM 688

Query: 1208 IKK--DKYGKKMKRQSSFGEPQVVDVIHENTMNKL-NQLHYLVGMEPSATDATVFLRLFG 1264
            I+K      K++ RQ   G       I  + +N++ NQ      +E  A  A V +++ G
Sbjct: 689  IEKVHRMMNKRVNRQRREG-------IKTSALNRIKNQYETSHDVEEEAEGAFVAMKVLG 741

Query: 1265 NEFGFVSASDVLALIPYTMGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTG 1324
            N+  +    D+  +        E L+     +    S   +LN      F      +PT 
Sbjct: 742  NDVFYKDRDDIERMAERFS--RERLMEIIASLVSQRSHEYSLNKN----FKTSKVTIPTI 795

Query: 1325 MGMPLNCSINGTAVVSLRMKSQFS----FNLPKIIAA-GHVAPSGAVEVLATMGIGMPTK 1379
             GMPL  +I G     L+   +         P+ +A  G   PS A+E+ + M +     
Sbjct: 796  AGMPLEVNIQGAFNTILKASGKLDVLGMMATPRRMAVQGLFEPSAAIEINSNMMVDAHC- 854

Query: 1380 VFTGVMANATVYHSSMLAGNITIDGTHLKINLNNTDRPMNLFNYSTTYNLLKANGDIEFI 1439
              +G+     +  S  L G+++ +   LK  +    R   + + S++   ++ N   E +
Sbjct: 855  ARSGLSHKTNMASSLSLGGSLSFENGMLKAKVTAPPRRETIIDASSSLFFMQRN---EMV 911

Query: 1440 P-GVLQDAVQSQRCTNVSKVFGVDLCVSWAYPNASYVAEAPRFPFSGPNSF------NVT 1492
            P    +DAV     T++ + F  D        N       P   FS P +F       +T
Sbjct: 912  PVSEPEDAV-----TSIEETFANDRY------NLHISGTRPNMAFSLPQAFFQNWRMEIT 960

Query: 1493 LVNTDQALKAYTIDAQYK 1510
            L   + +L +Y ++A ++
Sbjct: 961  LDKLEDSLVSYDLEAGFR 978
>ref|XP_392490.3| PREDICTED: similar to Retinoid- and fatty-acid binding protein
            CG11064-PA isoform 1 [Apis mellifera]
          Length = 3360

 Score =  134 bits (338), Expect = 3e-029
 Identities = 211/1049 (20%), Positives = 420/1049 (40%), Gaps = 129/1049 (12%)

Query: 474  FKEGYSYTFKYEAETESGIKGAGPGSNMTMTCDIIIEAPERCRNVLKARRCLLENRD-LD 532
            ++EG +Y +  E  + + I  A   +++ ++  + +     C N L+ +   +     L 
Sbjct: 92   YQEGRTYVYNLEGLSVTSITDAQGDASLKLSATVELSVKPDCINQLRLKNVKINGAPPLI 151

Query: 533  EEMSAHDLVFRTQNGRI-IEVLAHPDEPLHILNAKRGILSMIQLDLEADDVDQITLNEVS 591
             E+  + + F   +G I  ++   P +    LN KR ++SM Q  +  D    I  +E  
Sbjct: 152  PEIEQYAVQFNYHDGHIDTQLCTEPGDSQASLNIKRAVVSMFQSAIMQDSGSTIH-HETD 210

Query: 592  VHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENMTRWQSFKDMVLNMTVMDKF 651
            V G C +E    +  D     K +    L +C  R   EN+ +      +V   T  +  
Sbjct: 211  VMGTCPTEFNFRKEGDSLIVNKNR---NLASCAFR---ENVNQ-----GLVSGNTDAEAG 259

Query: 652  INSSKTC----SYDLKGTTGEFRGIQCEEVHSFWPMNFNSESGVRTFIQQRLISTAIDRL 707
            + SS       S + +   G       +E ++  P + N  +G  T ++  L       L
Sbjct: 260  VKSSPLLGSQQSIEQRFKRGILNKAVSKEQYTLRPFS-NGHAGANTNVETTLT------L 312

Query: 708  NSYKVDPANSRSTCLRYEHDPKEIGKKADDVTADQAMDILKALVKSSREEVQME-SPRLF 766
             S K D  N   T  +    PK I  ++       + D +   +K++R EV     P   
Sbjct: 313  KSEKAD--NPTVTVSQ----PKSIIFESPQPVLRSSADAVANALKAARAEVAGGVKPDAA 366

Query: 767  GRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIAREYLLDGLLPCTTMACFS 826
             R+   ++ +     +++       S Y +    + + +K+     LD L    T     
Sbjct: 367  SRFADLVKVLRVSGKNDIM------SVYQKVRSGDKEDQKL----FLDALFRARTGEAAE 416

Query: 827  VKNYAIA-KGVVPKPLASAWMVTMALQNYPTLELMSEMLRMA-QYSPSQITIFPLSIMVH 884
            V    I  K +        +  ++AL  +  L  ++ +  +  Q    ++    +  ++ 
Sbjct: 417  VGVELIKNKELTNVQTLLFYAGSLALIRHVHLPSVTAIASLLDQPDLPRLGYLGVGQVIG 476

Query: 885  NYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSAENERLALVALKAIGNIGEPVER 944
             Y   N   + A      I + +  ++  +GN    S E E   + ALKA+GN       
Sbjct: 477  RYCQQNSCENVAE-----IKQAVHKIREKVGNGKAKSREQENSIISALKALGN------- 524

Query: 945  YDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQLRSQVISELFKDTTL 1004
                +    +     L +   +K +   +  AAIQ++            V+ ++  D   
Sbjct: 525  ----SQFLDDATLQKLANIAADKNVRNRVRVAAIQALP--TRCSMKWKNVMFKVLADREE 578

Query: 1005 DVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIKNVVESSEPTLQEFK 1064
            D   RI  YL ++ A P       +   L  E VNQ+ +F  +H++N+  S++P     K
Sbjct: 579  DSEIRINTYL-SLVACPCPHAANQLKEVLDKETVNQVGSFIQTHLRNLRASTDPDKLNAK 637

Query: 1065 MNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFESDIIFNPESYLPQE 1124
                +    +   ++P+D RKYS   ELS  +      +T+    +S+++++  S++P+ 
Sbjct: 638  NQFGLI---KPRVKFPEDFRKYSFNNELSYKIDSLGLGSTL----DSNVVYSQNSFVPRS 690

Query: 1125 VMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQTMFDTIDEKILSKV 1184
               +  +   GK+ +  E    ++  + ++E   GP+G   E  L+    +   ++ +K+
Sbjct: 691  ANLNMTVELFGKNFNFLELNTRVENLDRLLEHYLGPKGKIWEKDLEEDLKSGANEV-NKL 749

Query: 1185 REFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQSSFGEPQVVDVIHENTMNKLNQLH 1244
            R++A  +                 +K   GK+  RQ        +D   +N   + N++ 
Sbjct: 750  RKYARER----------------FEKVVRGKREVRQGD------LDRFAKNVHLRSNEV- 786

Query: 1245 YLVGMEPSATDATVFLRLFGNEFGFVSAS------DVLALIPYTMGIYEELLNKTKQIPQ 1298
                      D  + ++LFG E+ ++S           A+I   +   E+  + TK +  
Sbjct: 787  ------DQDLDIDLSIKLFGVEYAYLSYQGEGSKLSPEAVIDKLLDGLEKGFDVTKNLKS 840

Query: 1299 LLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLRMKSQFSFNLPKIIAAG 1358
             L   L         F+D   + PT +G  L+  ++GT+  +LR+K+Q  F+L   +   
Sbjct: 841  DLENYLQ--------FLDNELVYPTNLGTALSLGLSGTS--ALRLKTQGKFDLKSALKDP 890

Query: 1359 H-------VAPSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGNIT-IDGTHLKIN 1410
                    V PS ++ +  +M +  P  V +G+    T++ S+    +++ +DGT + +N
Sbjct: 891  KNTNFRLAVEPSVSIRLAGSMTVQAP-GVESGMKIIGTLHTSTSTDVSVSLLDGTGIDVN 949

Query: 1411 LNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVLQDAVQSQRCTNVSKVFGVDLC--VSWA 1468
            +    +   + + S+        GD+   P   +    +      S   G+ +C  +S+ 
Sbjct: 950  IGIPKKKQEVISVSSEVLFSTPKGDV--APKFGKSKEYADCFEQFSSYLGLTVCGKISYP 1007

Query: 1469 YPNASYVAEAPRFPFSGPNSFNVTLVNTD 1497
            Y ++S + + P FP +GP  F V + N D
Sbjct: 1008 YDDSSSIDQKPLFPLNGPAEFAVKVENND 1036
>ref|XP_321226.3| ENSANGP00000018348 [Anopheles gambiae str. PEST]
          Length = 3260

 Score =  111 bits (278), Expect = 3e-022
 Identities = 199/980 (20%), Positives = 372/980 (37%), Gaps = 153/980 (15%)

Query: 542  FRTQNGRII-EVLAHPDEPLHILNAKRGILSMIQLDLEADDVDQITLNEVSVHGNCSSEM 600
            F   N  ++ E+    D+    LN KRG++S+ Q+  E          E  V G C +  
Sbjct: 72   FTLSNDELLPEICTEADDTDFSLNVKRGLISLFQVAQEKS-------TETDVFGVCQTSF 124

Query: 601  TVTRRDDKQRPRKLQVVTELNNCMLRKQEEN--MTRWQSFKDMVLNMTVMDKFINSSKTC 658
            +     D     K   V +L NC  R+   N  +TR  + K  + +  ++    N+ +T 
Sbjct: 125  SSYPSGDATVVEK---VRDLGNCAYRESLSNSFVTRIVNSKAGIKSTPLLQSSYNAQQT- 180

Query: 659  SYDLKGTTGEFRGIQCEEVHSFWPMNFNSESGVRTFIQQRLISTAIDRLNSYKVDPANSR 718
               +KG  G    ++  E + + P     + GV   +  +L  T     N     PA   
Sbjct: 181  ---IKG--GLLSAVKLSEEYQYLPY-LKDKVGVTAKVTTKLTLTG----NKAGAAPALGA 230

Query: 719  STCLRYEHDPKEIGKKADDVTADQAMDILKALVKSSREE-----VQMESPRLFGRWRAAL 773
            ++      +P+ I  +  D      + ++K  +KS+ E      V  ++  LF      +
Sbjct: 231  AS------EPRTIIFENPDQQPAGNLAVIKQELKSTVESYTNGNVGKKTANLFVELIQLM 284

Query: 774  EGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIAREYLLDGLLPCTTMACFSV-----K 828
                 E +  ++++    S +S         + +AR+  LD L    T           K
Sbjct: 285  RYSKKEDLLTLYNQVKAGSVHSN--------KSLARKVYLDALFRVGTGDAVEAITQLYK 336

Query: 829  NYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQYSPSQITIFPLSIMVHNYWM 888
            N  +  G   + LA    V++ L    T + +  + ++   +P +     +  +V  Y  
Sbjct: 337  NKELT-GAQEQKLA---FVSLTLVQSMTQDALKAVNKLLDGNPPREAYLSVGSLVSKYCQ 392

Query: 889  NNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSAENERLALVALKAIGNIGEPVERYDQL 948
             +            + +      + +G   + S   E + +  LK + N        D L
Sbjct: 393  KH------GCQSSDVKEISNKFGAKLGKCQSTSRAQEDVIVAVLKGVRNS-------DNL 439

Query: 949  TFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQLRSQVISELFKDTTLDVPQ 1008
                 ++V    I C       R +  AA+Q+      + ++ +  +S L KDT  D   
Sbjct: 440  VAPLLDKV----IQCAGPDASSR-VRVAALQAYPAASCNKKIVNAALSTL-KDTNEDSEI 493

Query: 1009 RIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIKNVVESSEPTLQEFKMNL- 1067
            RI AYL  ++  PS +   ++   L  E V Q+ +F  SH+ ++  S +PT    + +  
Sbjct: 494  RIHAYLSLVEC-PSANVANELKALLDAEKVYQVGSFITSHLASLRASVDPTRDAARQHFG 552

Query: 1068 KIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFESDIIFNPESYLPQEVMF 1127
            KI    +    +P D+R+YS     ++  +    +  V A  E+ +I++ +S+LP+ V  
Sbjct: 553  KIRTSNK----FPFDVRRYS----FNREFSYAVESLGVGASAETSVIYSQKSFLPKSVGL 604

Query: 1128 HYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQTMFDTIDE---KILSKV 1184
            ++     G  +++FE        E ++E  FGP+GFF  + +Q  +D + E   K+  K 
Sbjct: 605  NFTAELFGNGLNVFELEGRQDNLERLVEHYFGPKGFFSGMDMQAAYDLLAEQYQKLSGKA 664

Query: 1185 REFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMKRQSSFGEPQVVDVIHENTMNKLNQLH 1244
            +E     +                          R+      + VD +H + +   N   
Sbjct: 665  KERFRRGI--------------------------REDIRALARTVD-LHNDALKDFN--- 694

Query: 1245 YLVGMEPSATDATVFLRLFGNEFGFVSASDVLALIPYTMGIYEELLNKTKQIPQLLSQG- 1303
                         V +++FG+E  F+S  + +   P      E+ L+K  +    + +G 
Sbjct: 695  -----------LDVTMKVFGSELFFLSTGENVPTDP------EQFLDKALECFDKMIEGA 737

Query: 1304 --LNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTAVVSLRMKSQFSFNLPKIIAAGHVA 1361
                       +F+D   +  T +G+PL  S  G  V   R+ +    ++  ++     A
Sbjct: 738  KKFEHTFEHHALFLDTDLVYTTALGLPLKLSAQGAGVA--RVDAALELDVKSLVKDYSNA 795

Query: 1362 -------PSGAVEVLATMGIGMPTKVFTGVMANATVYHSSMLAGNITI-DGTHLKINLNN 1413
                   PSG+ EV  TM +     V TG+    + + S   A    + D T   + ++ 
Sbjct: 796  KFNTKFQPSGSFEVTGTMSVD-AFNVMTGMQVAVSGHSSGGAAVKFALHDATAYDLTVDA 854

Query: 1414 TDRPMNL--FNYSTTYNLLKANGDIEFIPGVLQD--AVQSQRCTNVSKVFGVDLCVSWAY 1469
                  L   N+       +    +  +P   QD  +  S+   N+  V GV +C +   
Sbjct: 855  LQGKQELVSVNFREVIITRERGNQLITLPAKRQDFGSKFSECFDNLYSVIGVTVCAAHKV 914

Query: 1470 PNAS----YVAEAPRFPFSG 1485
                    Y+   P+F FSG
Sbjct: 915  DQEELFEVYLEVEPKFHFSG 934
>ref|XP_001352351.1| GA10736-PA [Drosophila pseudoobscura]
          Length = 3355

 Score =  107 bits (268), Expect = 4e-021
 Identities = 200/942 (21%), Positives = 362/942 (38%), Gaps = 146/942 (15%)

Query: 551  EVLAHPDEPLHILNAKRGILSMIQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQR 610
            E+ +  ++  + LN KR I+S++Q   ++D       +E+ V G C +  + ++  + + 
Sbjct: 130  EICSDSNDAAYSLNIKRAIISLLQSGTDSD-------HEIDVFGQCKTHTSSSKAGNAEV 182

Query: 611  PRKLQVVTELNNCMLRKQEENMTRWQSFKDMVLNMTVMDKFINSSKTCSY----DLKGTT 666
              K   V  LNNC  R+Q  +         +V  +      I SS         +LK   
Sbjct: 183  ITK---VRNLNNCAYREQINS--------GLVSGVVNEKAGITSSLLLEANYIKELKIGG 231

Query: 667  GEFRGIQCEEVHSF-WPMNFNSESGVRTFIQQRLISTAIDRLNSYKVDPANSRSTCLRYE 725
            G    +Q  E + F      NSE   +     +L + A  + N+    PA   +      
Sbjct: 232  GVIENVQLVETYRFIGSARGNSEISAKAITSLKLKNPAGTKANA----PATGATARSLLF 287

Query: 726  HDPKEIGKKADDVTADQAMDILKALVKSSREEVQMESPRLFGRWRAALEGMNNETIHEVF 785
              P+    K      +    IL  LV S+ E V+ +S + F  +   L   +++T+ E+ 
Sbjct: 288  QKPETYTSK----NINSLKTILSDLVDSTTEYVKKDSAKKFVEFIRLLRQSDSDTLLEL- 342

Query: 786  DRAYNCSAYSQTCRDNPDKEKIAREYLLDGLLPCTTMACFSVKNYAIAKGVVPKPLASAW 845
                   A+      +P+K  +AR+  LDGL    T    +    AI K +         
Sbjct: 343  ------GAFP-----HPNKV-LARKVYLDGLFRTNT----AESAVAILKQLSKLGDKEQV 386

Query: 846  MVTMALQNYPTLELMSEMLRMAQYSPSQITIFPLSI--MVHNYWMNNEEIHTAATLPEPI 903
            +  ++L    +++  +     +Q SPS      LS+  +V  Y   +          E  
Sbjct: 387  IAILSLNLVESVDKNTLNQAASQLSPSAHKELYLSVGSLVAKYCAQH-----GCQAGEID 441

Query: 904  VKTIRYLKSLIGNDCTVSAENERLALVALKAIGNIGEPVERYDQLTFIFSERVSPVLISC 963
            + + ++  SL         E ER+  + LK IGN               +   +  L  C
Sbjct: 442  LISKKFTDSLKQCKPNTKKEEERIVYI-LKGIGNAQA-----------LAGTTAAALSEC 489

Query: 964  TKNKQIPRDISKAAIQSMRRFVMSDQLRSQVISELFKDTTLDVPQRIAAYLITMKANPSV 1023
                +  R I  AA+Q+         L+ + + EL KD   D   RI AYL  +   P+ 
Sbjct: 490  ASTGRSNR-IRVAALQAFSAVTCDPTLQKKSL-ELLKDHNEDSELRIEAYLSAISC-PNA 546

Query: 1024 SELTDIWNFLKTEPVNQMKAFCYSHIKNVVESSEPTLQEFKMNLKIAMDGEELPEYPKDI 1083
                ++   + +E V Q+  F  S +K + +S++PT ++ K +L    +     ++P++ 
Sbjct: 547  EVANEVSQVVNSENVYQVGGFISSSLKAIRDSTDPTREQQKYHLA---NIRVTKKFPRNY 603

Query: 1084 RKYSRFFELSKNLTEPWRNNTVAAQFESDIIFNPESYLPQEVMFHYVLNALGKSMDIFET 1143
            R+YS   ELS  L        ++A  +  +I++   +LP+    +      G S ++FE 
Sbjct: 604  RRYSFNNELSYKLDALG----LSASSDYKLIYSQNGFLPRSSRINVTTEIFGTSFNVFEA 659

Query: 1144 GIEMKGFEPIIESVFGPEGFFPEVKLQTMFDTIDEKILSKVREFAEAQLGNWVTPTSEPD 1203
             +  +  E I+E   GP+G      L   FD I  K++      A A  G     +   D
Sbjct: 660  SVRQENLENILEYYLGPKGL-----LNKDFDEI-VKLIEVTGAGAGAGAGGRARRSIADD 713

Query: 1204 NEVFIKKDK-YGKKMKRQSSFGEPQVVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRL 1262
                 KK K YG K K+                                   +  + L+L
Sbjct: 714  AAKTSKKYKTYGSKNKQD---------------------------------LNLDLSLKL 740

Query: 1263 FGNEFGFVSASDVLALIPYTMG----IYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKS 1318
            FG+E  F+S  D +   P TM      + E  +K K                  +F+D  
Sbjct: 741  FGSELAFLSLGDNM---PSTMDDIIRHFSEAFDKAKND----LSSFEKQFASHHLFLDTE 793

Query: 1319 FIVPTGMGMPLNCSINGTA------VVSLRMKSQFSFNLPKIIAAGHVAPSGAVEVLATM 1372
            F  PTG+G+PL  +  G A       V++ + +    N  ++       PS  ++V   +
Sbjct: 794  FSYPTGVGVPLELTAQGFAANKIDFAVNIDVNAILEQNWQRVKYRLKFVPS--IDVNVNV 851

Query: 1373 GIGMPTKVFTGVMANATVYHSSMLAGNITI----DGTHLKINLNNTDRPMNLFNYSTTYN 1428
             IG   +V +  +  A+  HS+    ++T+    DG    +++      + + +      
Sbjct: 852  QIGFNAQVLSTGLRVASTAHSA-TGNDVTVALINDGEGFNVDVELPREKLEIIDVKINTE 910

Query: 1429 LLKANGDIEFIPGVL-----QDAVQSQRCTNVSKVFGVDLCV 1465
               A  D +    +      +++  S+ C N  ++ G ++C+
Sbjct: 911  FFVAEQDKQKSVALKATKTNKNSQPSELCFNQLEIVGFNVCI 952
>ref|NP_524634.2| Retinoid- and fatty-acid binding protein CG11064-PA [Drosophila
            melanogaster]
          Length = 3351

 Score = 96.3 bits (238), Expect = 1e-017
 Identities = 188/923 (20%), Positives = 358/923 (38%), Gaps = 134/923 (14%)

Query: 563  LNAKRGILSMIQLDLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNN 622
            LN KR ++S++Q  +EA+       +EV V G C +  + ++  +     K +    LN+
Sbjct: 142  LNIKRAVVSLLQSGIEAE-------HEVDVFGMCPTHTSTSKVGNANIITKAR---NLNS 191

Query: 623  CMLRKQEEN---MTRWQSFKDMVLNMTVMDKFINSSKTCSYDLKGTTGEFRGIQCEEVHS 679
            C  R+Q  +     +      +  ++ +   +I  S+  ++ ++        +Q  E + 
Sbjct: 192  CSHREQINSGLVSGKVNEKAGITSSLLLQANYIKESRIVNHLIEN-------VQLTETYK 244

Query: 680  F-WPMNFNSESGVRTFIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGKKADDV 738
            F      NS+   +     +L + +  + NS    P    +        P+    K    
Sbjct: 245  FIGNTKRNSDISAKVVTILKLKNPSGTKANS----PGTGSTVRSLIFQRPETYTSK---- 296

Query: 739  TADQAMDILKALVKSSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTC 798
              +    IL  LV S+ + V+ E+ + F  +   L   ++ET+ E+              
Sbjct: 297  NINALKTILSDLVDSTGDYVKKETAKKFVEFIRLLRQSDSETLLEL------------AA 344

Query: 799  RDNPDKEKIAREYLLDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLE 858
              +P+K  +AR+  LDGL   +T     V    ++K    + L +   + + +++     
Sbjct: 345  FPHPNKV-LARKVYLDGLFRTSTAESARVILKQLSKFDEKEKLLAILSLNI-VKSVDKET 402

Query: 859  LMSEMLRMAQYSPSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDC 918
            L     ++   +P ++ I  +  +V  Y + N         PE    + ++   L     
Sbjct: 403  LNQAASQLLPNAPKELYI-AVGNLVAKYCLKNY-----CQGPEIDAISKKFSDGLKHCKP 456

Query: 919  TVSAENERLALVALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAI 978
                E ER+  + LK +GN               S      L  C    +  R I  AA+
Sbjct: 457  NTKREEERIVYI-LKGLGNAKS-----------LSGNTVAALSECASTGRSNR-IRVAAL 503

Query: 979  QSMRRFVMSDQLRSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPV 1038
             +  +    + L+S+ + EL K+   D   RI AYL  +   P+      I   + +E V
Sbjct: 504  HAFSKVKCEETLQSKSL-ELLKNRNEDSELRIEAYLSAISC-PNAEVANQISEIVNSETV 561

Query: 1039 NQMKAFCYSHIKNVVESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTE 1098
            NQ+  F  S++K + +S++ +  + K +L    +      +P D R+YS   E+S  L  
Sbjct: 562  NQVGGFISSNLKAIRDSTDVSRDQQKYHLA---NIRVTKTFPVDYRRYSFNNEVSYKL-- 616

Query: 1099 PWRNNTVAAQFESDIIFNPESYLPQEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVF 1158
               +  V A  +  II++   +LP+    +      G + ++FE  +  +  E ++E   
Sbjct: 617  --ESLGVGASTDYQIIYSQHGFLPRSSRINVTTEFFGTNYNVFEASVRQENVEDVLEYYL 674

Query: 1159 GPEGFFPEVKLQTMFDTIDEKILSKVREFAEAQLGNWVTPTSEPDNEVFIKKDKYGKKMK 1218
            GP+G      +   FD I + I          ++GN             +  D   K  K
Sbjct: 675  GPKGL-----VNKDFDEIVKLI----------EVGNNGVAAGGRARRSIV--DDVSKISK 717

Query: 1219 RQSSFGEPQVVDVIHENTMNKLNQLHYLVGMEPSATDATVFLRLFGNEFGFVSASD-VLA 1277
            +   +G   V D+                       +  V L+LFG+E  F+S  D + +
Sbjct: 718  KYKMYGVKNVQDL-----------------------NLDVSLKLFGSELAFLSLGDNIPS 754

Query: 1278 LIPYTMGIYEELLNKTKQIPQLLSQGLNLNTTRSFVFMDKSFIVPTGMGMPLNCSINGTA 1337
             +   +  +     K KQ  +L S       +   +F+D     PT +G+PL     G A
Sbjct: 755  SLDDIINYFSTSFEKAKQ--ELSS--FEKQFSSHHLFLDTDLAYPTSIGVPLELVAQGFA 810

Query: 1338 ------VVSLRMKSQFSFNLPKIIAAGHVAPSGAVEVLATMGIGMPTKVFTGVMANATVY 1391
                   VSL + +    N  K        PS  V++ A + IG   +V +  +   +  
Sbjct: 811  ATKVDLAVSLDINAILEQNWQKAKYRLKFVPS--VDINANVQIGFNAQVLSTGLRVVSSA 868

Query: 1392 HSSMLAGNITI----DGTHLKINLNNTDRPMNLFNYSTTYNLLKANGDIEFIPGVL---- 1443
            HS+    +IT+    DG    ++L      + L N++    L  A  D +    +     
Sbjct: 869  HSA-TGSDITVAVISDGEGFNVDLELPREKLELINFNVDTELYVAEQDKQKAIALKGNKK 927

Query: 1444 -QDAVQSQRCTNVSKVFGVDLCV 1465
             +++  S+ C N  ++ G+++C+
Sbjct: 928  NKNSQPSEICFNQLELVGLNICI 950
>ref|NP_001004408.1| hypothetical protein LOC424547 [Gallus gallus]
          Length = 1912

 Score = 89.7 bits (221), Expect = 1e-015
 Identities = 147/746 (19%), Positives = 301/746 (40%), Gaps = 84/746 (11%)

Query: 474  FKEGYSYTFKYEAETESGIKGAG---PGSNMTMTCDIIIEAPERCRNVLKA--------- 521
            F E   YT+ YE+   SGI   G    G  +    +I    P+ C   + +         
Sbjct: 24   FGENKVYTYNYESILFSGIPEKGLARTGIRIRSEVEISGIGPKLCLIRIHSIEAAEYNGI 83

Query: 522  ------RRCLLENRDLDEEMSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGILSMIQL 575
                   R L   + L  ++S   + F   NG +  ++A        LN  RGIL++++L
Sbjct: 84   WPTSSFSRSLKLTQALTGQLSI-PIKFEYSNGHVGNLMAPDSVSDDGLNIYRGILNILEL 142

Query: 576  DLEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENMTRW 635
             L+       ++ E  + G C++   + + + K     +    +LN+C   +++  +   
Sbjct: 143  SLKKMQ-HSYSIQEAGIGGICNTTYAI-QENKKANLVDVTKSKDLNSC---EEKVQVVTG 197

Query: 636  QSFKDMVLNMTVMDKFINSSKTCSYDLKGTTGE--FRGIQCEEVHSFWPMNFNSESGVRT 693
             ++          +K   ++ T +Y +K T  E      + EEVH F P +  +      
Sbjct: 198  SAYTQPCQTCQQRNKNSRATATYNYKIKYTHNEAVITQAEVEEVHQFTPFHEITGGNAIV 257

Query: 694  FIQQRLISTAIDRLNSYKVDPANSRSTCLRYEHDPKEIGK-----KADDVTADQAMDILK 748
              +Q+L    + +  +        +   L+Y+   + +       K  DV   Q  + L+
Sbjct: 258  EARQKLALIEVQKQVAEVPPKEFQKRGSLQYQFGSELLQLPVHLFKIKDVER-QIEERLQ 316

Query: 749  ALVKSSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDNPDKEKIA 808
             LV+++ E++  ++P    +    L   N E    V+ +  +  AY              
Sbjct: 317  DLVETTYEQLPSDAPAKALKLMHLLRAANEENYESVWKQFSSRPAY-------------- 362

Query: 809  REYLLDGLLPCTTMACFSVKNYAIAKGVVPKPLASAWMVTMAL-----QNYPTLELMSEM 863
            R YLLD LLP    A  S ++    +  + +   + W +   +      + PT E+M E 
Sbjct: 363  RRYLLD-LLP----AAASHRSLRFLRHKMERQELTNWEIAQTVLVALHSSSPTQEVMEEA 417

Query: 864  -LRMAQYSPSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSA 922
             L + ++ P   ++     ++    +     H   + P    + ++      G    +  
Sbjct: 418  TLIVKKHCPRSSSVLRKVCLLSYASL----CHKRCSSPYSCSECLQVFHVFAGE--ALGK 471

Query: 923  ENERLALVALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMR 982
             N    L+ALKA+GN+G P        F+                ++P  + + A+ +++
Sbjct: 472  SNIEEVLLALKALGNVGHPASIKHIKKFLPGYAAGA--------SELPLKVHETAVMALK 523

Query: 983  RFVMSDQLRSQVIS-ELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQM 1041
               M D    Q I+ E+F +  +    R+ A ++ ++  P +  L  + + +  EP  Q+
Sbjct: 524  SIGMRDPQMVQAITLEIFLNHKIHPRIRMLAAVVLLETKPGLPILMILVDAVLKEPSMQV 583

Query: 1042 KAFCYSHIKNVVESSEPTLQEFKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWR 1101
             +F YSH++ +  S+ P LQ      ++A+     P++ +   ++S+ F  S  + + + 
Sbjct: 584  ASFIYSHLRALGRSTAPDLQMMASACRMAVRALS-PKFDRSGYQFSKVFRFS--MFKEFL 640

Query: 1102 NNTVAAQFESDIIFNPESYLPQEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPE 1161
             + +AA++   ++ N  S +P   +     + LG+  D  E GI  +G + +        
Sbjct: 641  MSGLAAKY--FVLNNAGSLIPTMAVSQLRTHFLGRVADPIEVGIAAEGLQEMF-----VR 693

Query: 1162 GFFPEVKLQTMFDTIDEKILSKVREF 1187
            G+ P+   +T +D    +IL K+ ++
Sbjct: 694  GYSPDKDWETNYDF--REILKKLSDW 717
>ref|NP_001026447.1| hypothetical protein LOC424533 [Gallus gallus]
          Length = 1850

 Score = 82.4 bits (202), Expect = 2e-013
 Identities = 140/687 (20%), Positives = 264/687 (38%), Gaps = 82/687 (11%)

Query: 542  FRTQNGRIIEVLAHPDEPLHILNAKRGILSMIQLDLEADDVDQITLNEVSVHGNCSSEMT 601
            F   +GRI  + A  D P   +N  RGIL+M Q+ ++    +   L E  + G C +   
Sbjct: 109  FEYSSGRIGNIYAPEDCPDLCVNIVRGILNMFQMTIKKSQ-NVYELQEAGIGGICHARYV 167

Query: 602  VTRRDDKQRPRKLQVVT-ELNNCMLRKQEENMTRWQSFKDMVLNMTVMDKFINSSKTC-S 659
            +  ++D++  R     T +LNNC  + Q+     +         + VM + +    T  S
Sbjct: 168  I--QEDRKNSRIYVTRTVDLNNCQEKVQKSIGMAYI----YPCPVDVMKERLTKGTTAFS 221

Query: 660  YDLKGTTGE--FRGIQCEEVHSFWPMNFNSESGVRTFI---QQRLISTAIDRLNSYKVDP 714
            Y LK +        +   +V+   P  FN  +GV       Q  L+    +R ++  V  
Sbjct: 222  YKLKQSDSGTLITDVSSRQVYQISP--FNEPTGVAVMEARQQLTLVEVRSERGSAPDVPM 279

Query: 715  ANSRSTCLRYE----HDPKEIGKKADDVTADQAMDILKALVKSSREEVQMESPRLFGRWR 770
             N  S   R+       P ++ K  +     + ++ L+ +V +++++   +    F    
Sbjct: 280  QNYGSLRYRFPAVLPQMPLQLIKTKNP--EQRIVETLQHIVLNNQQDFHDDVSYRFLEVV 337

Query: 771  AALEGMNNETIHEVFDRAYNCSAYSQ------TCRDNPDKEKIAREYLL-DGLLPCTTMA 823
                  N + +  ++ +  +   Y +      +     +  K  +  +  D L    T+ 
Sbjct: 338  QLCRIANADNLESIWRQVSDKPRYRRWLLSAVSASGTTETLKFLKNRIRNDDLNYIQTLL 397

Query: 824  CFSVKNYAIAKGVVPKPLASAWMVTMALQNYPTLELMSEMLRMAQYSPSQITIFPLSIMV 883
              S+  + +       P+A+  M +  +Q  P L+              Q+     S +V
Sbjct: 398  TVSLTLHLLQADEHTLPIAADLMTSSRIQKNPVLQ--------------QVACLGYSSVV 443

Query: 884  HNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTVSAENERLALVALKAIGNIGEPVE 943
            + Y          +  P+  ++ I  L      D  +S   E    +ALK IGN+GEP  
Sbjct: 444  NRYCSQT------SACPKEALQPIHDLA-----DEAISRGREDKMKLALKCIGNMGEPAS 492

Query: 944  RYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQSMRRFVMSDQLRSQ-VISELFKDT 1002
                L F+         IS +    IP  I   AI ++++    D    Q  + ++  D 
Sbjct: 493  LKRILKFL--------PISSSSAADIPVHIQIDAITALKKIAWKDPKTVQGYLIQILADQ 544

Query: 1003 TLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVNQMKAFCYSHIKNVVESSEPTLQE 1062
            +L    R+ A  +  +  P+++ +T I N    E   Q+ +F YSH+K++ +S  P +  
Sbjct: 545  SLPPEVRMMACAVIFETRPALALITTIANVAMKESNMQVASFVYSHMKSLSKSRLPFMYN 604

Query: 1063 FKMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLTEPWRNNTVAAQFESDIIFNPESYLP 1122
                  IA+     P+      +YS+           + N  V A  E  ++ +P +  P
Sbjct: 605  ISSACNIALKLLS-PKLDSMSYRYSKVIRADTY----FDNYRVGATGEIFVVNSPRTMFP 659

Query: 1123 QEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESVFGPEGFFPEVKLQTMFDTIDEKILS 1182
              ++   + N+ G   D+ E GI ++G   +I     P   +P  K              
Sbjct: 660  SAIISKLMANSAGSVADLVEVGIRVEGLADVIMKRNIPFAEYPTYK-------------- 705

Query: 1183 KVREFAEAQLGNWVTPTSEPDNEVFIK 1209
            +++E  +A  G    PT  P    ++K
Sbjct: 706  QIKELGKALQGWKELPTETPLVSAYLK 732
>ref|XP_001255069.1| PREDICTED: similar to apo-B100 [Bos taurus]
          Length = 192

 Score = 69.3 bits (168), Expect = 2e-009
 Identities = 42/135 (31%), Positives = 64/135 (47%), Gaps = 19/135 (14%)

Query: 470 ELTRFKEGYSYTFKYEAETESGIKGAGPGSNMT-MTCDIIIEAPERCRNVLKARRCLLEN 528
           +  RFK    Y + YEAE+ SG+ G     + T + C + +E P+ C  +LK   C L+ 
Sbjct: 39  DAVRFKHLRKYVYNYEAESSSGVPGTADSRSATKINCKVELEVPQLCNFILKTSDCTLKE 98

Query: 529 RD-LDEE-----------------MSAHDLVFRTQNGRIIEVLAHPDEPLHILNAKRGIL 570
            D L+ E                 MS +DL      G+ + +    +EP HILN KRGI+
Sbjct: 99  VDGLNPEGKALLKKTKNSEEFAAAMSKYDLKLAVPEGKQVLLYPEKEEPKHILNIKRGII 158

Query: 571 SMIQLDLEADDVDQI 585
           S + L  E ++  Q+
Sbjct: 159 SALLLPPETEEAKQV 173
>ref|NP_001038378.1| hypothetical protein LOC559931 [Danio rerio]
          Length = 1631

 Score = 69.3 bits (168), Expect = 2e-009
 Identities = 153/781 (19%), Positives = 302/781 (38%), Gaps = 103/781 (13%)

Query: 474  FKEGYSYTFKYEAETESGIKGAGPG-SNMTMTCDIIIEAPERCRNVLK------------ 520
            F    +Y +KYEA   SGI   G   + + +   +++ A      +LK            
Sbjct: 24   FAHDKTYVYKYEALLLSGIVQEGLAKAGIQIKSKVLLSAATENTFLLKFVDPLFYEYAGT 83

Query: 521  -ARRCLLENRDLDEEMSAH---DLVFRTQNGRIIEVLAHPDEPLHILNAKRGILSMIQLD 576
              +  +     L+  ++A     + F   NG + +V A       +LN  RGIL+++QL+
Sbjct: 84   WPKDQVFPATKLNSALAAQLQTPIKFEYANGVVGKVFAPAGVSPSVLNLYRGILNILQLN 143

Query: 577  LEADDVDQITLNEVSVHGNCSSEMTVTRRDDKQRPRKLQVVTELNNCMLRKQEENMTRWQ 636
             +    +   L E    G C ++  ++  D K     +    +L++C  R  ++      
Sbjct: 144  FKKTQ-NIYELQEAGAQGVCKTQYVISE-DPKADRITVTKSRDLSHCQERIVKDIGL--- 198

Query: 637  SFKDMVLNMTVMDKFINSSKTCSYDLKGTTGE--FRGIQCEEVHSFWPMNFNSESGVRTF 694
            ++ +  +  T   K +  +   +Y +K +           +EVH F P N          
Sbjct: 199  AYTETCVECTKRIKSLIETANYNYIIKPSDSGALIAEATVKEVHQFSPFN-EIHGAAMME 257

Query: 695  IQQRLISTAIDRLNSYKVDPANSRSTCLRYE------HDPKEIGKKADDVTADQAMDILK 748
              Q L+    ++     V         L+YE        P ++ K ++     Q  ++LK
Sbjct: 258  ATQSLVFVEFEKAPVVPVKADYMPRGSLQYEFATEILQTPIQLTKISN--APAQIKEVLK 315

Query: 749  ALVKSSREEVQMESPRLFGRWRAALEGMNNETIHEVFDRAYNCSAYSQTCRDN------P 802
             LV+++   V  ++P  F +    L     +    ++ +  +   Y +   D       P
Sbjct: 316  HLVENNVAMVHDDAPLKFVQLVQFLRAATLKDTEAIWAQFKDKPVYRRWLLDTLPAVATP 375

Query: 803  DKEKIAREYLLDGLLPCTTMACFSVKNYAIAKGVVPKPLASA-WMVTMAL-QNYPTLELM 860
               K  +E  L G    T      +    +A  +VP  L +  W  ++AL +   T+  +
Sbjct: 376  VVLKFIKEKFLAGEFTLTEF----IPTLVVALQMVPADLETIQWTASLALHEKIATIPAL 431

Query: 861  SEMLRMAQYSPSQITIFPLSIMVHNYWMNNEEIHTAATLPEPIVKTIRYLKSLIGNDCTV 920
             E++ +   S           M+  Y +         T P  +++ I  + +       +
Sbjct: 432  REVVMLGYGS-----------MIAKYCV------AVPTCPAELLRPIHEIATE-----AI 469

Query: 921  SAENERLALVALKAIGNIGEPVERYDQLTFIFSERVSPVLISCTKNKQIPRDISKAAIQS 980
            S  +     +ALK +GN G P      +  +      PVL   T    +P  +   AI +
Sbjct: 470  SKNDIPEITLALKVLGNAGHPSSLKPIMKLL------PVLK--TTASALPIRVQVDAILA 521

Query: 981  MRRFVMSD-QLRSQVISELFKDTTLDVPQRIAAYLITMKANPSVSELTDIWNFLKTEPVN 1039
            +R     + +L   V  +L  +  L    R+ A ++  +  PSV+ ++ +   L+ E   
Sbjct: 522  LRSIAKKEPKLVQPVALQLVLERALHPELRMVACILLFETKPSVAVMSSLAGALRMETNM 581

Query: 1040 QMKAFCYSHIKNVVESSEPTLQEF--KMNLKIAMDGEELPEYPKDIRKYSRFFELSKNLT 1097
            Q+ +F YSHIK++   + P +       N+ I +   +L        +YSR F+L    T
Sbjct: 582  QVASFAYSHIKSLTRITAPDMSSVAGAANVAIKLMNRKLDRLN---FRYSRAFQLDFYHT 638

Query: 1098 EPWRNNTVAAQFESDIIFNPESYLPQEVMFHYVLNALGKSMDIFETGIEMKGFEPIIESV 1157
                   + A   + +I +  + LP+ V+        G + D+ E G+  +G +  +   
Sbjct: 639  P----LMIGAAGSAYMINDAATILPRAVIAKARAYLAGAATDVIEFGLRTEGIQEAL--- 691

Query: 1158 FGPEGFFPEVKLQTMFDTIDEKILSKVREFAEAQLGNW-VTPTSEPDNEVFIKKDKYGKK 1216
                     +K     +++D   ++K++    A L NW   P+++P    ++K   +G++
Sbjct: 692  ---------LKSPAADESVDR--ITKIKRTLRA-LTNWKAMPSNKPLASAYVK--VFGQE 737

Query: 1217 M 1217
            M
Sbjct: 738  M 738
  Database: NCBI Protein Reference Sequences
    Posted date:  May 25, 2007  6:17 PM
  Number of letters in database: 999,999,922
  Number of sequences in database:  2,768,456
  
Lambda     K      H
   0.318    0.132    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,941,705,359
Number of Sequences: 2768456
Number of extensions: 164913267
Number of successful extensions: 387172
Number of sequences better than 1.0e-005: 34
Number of HSP's better than  0.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 27
Number of HSP's that attempted gapping in prelim test: 386821
Number of HSP's gapped (non-prelim): 158
length of query: 2141
length of database: 999,999,922
effective HSP length: 145
effective length of query: 1996
effective length of database: 598,573,802
effective search space: 1194753308792
effective search space used: 1194753308792
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 136 (57.0 bits)